Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human GTF2A2 Monoclonal Antibody | anti-GTF2A2 antibody

GTF2A2 (Transcription Initiation Factor IIA Subunit 2, General Transcription Factor IIA Subunit 2, TFIIA p12 Subunit, TFIIA-12, TFIIAS, Transcription Initiation Factor IIA gamma Chain, TFIIA-gamma, TF2A2) (Biotin)

Gene Names
GTF2A2; TF2A2; TFIIA; T18745; TFIIAS; HsT18745; TFIIA-12; TFIIA-gamma
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GTF2A2; Monoclonal Antibody; GTF2A2 (Transcription Initiation Factor IIA Subunit 2; General Transcription Factor IIA Subunit 2; TFIIA p12 Subunit; TFIIA-12; TFIIAS; Transcription Initiation Factor IIA gamma Chain; TFIIA-gamma; TF2A2) (Biotin); anti-GTF2A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B9
Specificity
Recognizes human GTF2A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GTF2A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-109 from human GTF2A2 (AAH00287) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(Western Blot analysis of GTF2A2 expression in transfected 293T cell line by GTF2A2 monoclonal antibody. Lane 1: GTF2A2 transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GTF2A2 expression in transfected 293T cell line by GTF2A2 monoclonal antibody. Lane 1: GTF2A2 transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GTF2A2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GTF2A2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-GTF2A2 antibody
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Product Categories/Family for anti-GTF2A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
12,457 Da
NCBI Official Full Name
Homo sapiens general transcription factor IIA, 2, 12kDa, mRNA
NCBI Official Synonym Full Names
general transcription factor IIA subunit 2
NCBI Official Symbol
GTF2A2
NCBI Official Synonym Symbols
TF2A2; TFIIA; T18745; TFIIAS; HsT18745; TFIIA-12; TFIIA-gamma
NCBI Protein Information
transcription initiation factor IIA subunit 2

NCBI Description

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM, Mar 2008]

Research Articles on GTF2A2

Similar Products

Product Notes

The GTF2A2 (Catalog #AAA6142195) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GTF2A2 (Transcription Initiation Factor IIA Subunit 2, General Transcription Factor IIA Subunit 2, TFIIA p12 Subunit, TFIIA-12, TFIIAS, Transcription Initiation Factor IIA gamma Chain, TFIIA-gamma, TF2A2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTF2A2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTF2A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.