Mouse anti-Human CHRNA5 Monoclonal Antibody | anti-CHRNA5 antibody

CHRNA5 (Neuronal Acetylcholine Receptor Subunit alpha-5, NACHRA5) (Biotin)

Cat. Num. AAA6141193

• Gene Names: CHRNA5; LNCR2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHRNA5; Monoclonal Antibody; CHRNA5 (Neuronal Acetylcholine Receptor Subunit alpha-5; NACHRA5) (Biotin); anti-CHRNA5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 7D3
• Specificity: Recognizes human CHRNA5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CHRNA5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa38-131 from human CHRNA5 (NP_000736) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged CHRNA5 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CHRNA5 antibody

Nicotinic acetylcholine receptors, also known as nAChRs, belong to a family of proteins called ligand gated ion channels and are widely expressed throughout the nervous system. nAChRs are made up of 5 subunits (two alpha and three beta). Nicotinic Acetylcholine Receptor a5 has an ax ay beta combination. In the CNS, the a5 subunit is widely expressed in the CA1 area of the hippocampus which affects learning, memory, attention, anxiety, and potentially drug seeking behaviors.

Product Categories/Family for anti-CHRNA5 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 33589827
• NCBI GeneID: 1138
• NCBI Accession #: NP_000736
• NCBI GenBank Nucleotide #: NM_000745
• UniProt Accession #: P30532
• Molecular Weight: 53kDa
• NCBI Official Full Name: neuronal acetylcholine receptor subunit alpha-5 isoform 1
• NCBI Official Synonym Full Names: cholinergic receptor nicotinic alpha 5 subunit
• NCBI Official Symbol: CHRNA5
• NCBI Official Synonym Symbols: LNCR2
• NCBI Protein Information: neuronal acetylcholine receptor subunit alpha-5
• UniProt Protein Name: Neuronal acetylcholine receptor subunit alpha-5
• Protein Family: Neuronal acetylcholine receptor
• UniProt Gene Name: CHRNA5
• UniProt Synonym Gene Names: NACHRA5
• UniProt Entry Name: ACHA5_HUMAN

NCBI Description

The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).[provided by RefSeq, Jun 2010]

Uniprot Description

nAChRA5: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 5/CHRNA5 sub-subfamily.

Protein type: Membrane protein, multi-pass; Channel, ligand-gated; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; plasma membrane; cell junction

Molecular Function: acetylcholine receptor activity; nicotinic acetylcholine-activated cation-selective channel activity; ligand-gated ion channel activity

Biological Process: synaptic transmission; transport; behavioral response to nicotine; signal transduction; cation transport

Disease: Smoking As A Quantitative Trait Locus 3