Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CHP expression in transfected 293T cell line by CHP polyclonal antibody. Lane 1: CHP transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CHP Polyclonal Antibody | anti-CHP antibody

CHP (Calcineurin B Homologous Protein 1, Calcineurin B-like Protein, Calcium-binding Protein CHP, Calcium-binding Protein p22, EF-hand Calcium-binding Domain-containing Protein p22, CHP1) (FITC)

Gene Names
CHP1; CHP; p22; p24; Sid470p; SLC9A1BP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHP; Polyclonal Antibody; CHP (Calcineurin B Homologous Protein 1; Calcineurin B-like Protein; Calcium-binding Protein CHP; Calcium-binding Protein p22; EF-hand Calcium-binding Domain-containing Protein p22; CHP1) (FITC); anti-CHP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CHP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CHP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CHP, aa1-195 (NP_009167.1).
Immunogen Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CHP expression in transfected 293T cell line by CHP polyclonal antibody. Lane 1: CHP transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CHP expression in transfected 293T cell line by CHP polyclonal antibody. Lane 1: CHP transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CHP antibody
Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na+/H+ exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum-and GTPase-stimulated Na+/H+ exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto-and substrate-phosphorylations in a calcium-dependent manner.
Product Categories/Family for anti-CHP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,456 Da
NCBI Official Full Name
calcineurin B homologous protein 1
NCBI Official Synonym Full Names
calcineurin-like EF-hand protein 1
NCBI Official Symbol
CHP1
NCBI Official Synonym Symbols
CHP; p22; p24; Sid470p; SLC9A1BP
NCBI Protein Information
calcineurin B homologous protein 1; SLC9A1 binding protein; calcineurin B-like protein; calcium binding protein P22; calcium-binding protein CHP; calcium-binding protein p22; calcineurin homologous protein; calcineurin-like EF hand protein 1; EF-hand calc
UniProt Protein Name
Calcineurin B homologous protein 1
Protein Family
UniProt Gene Name
CHP1
UniProt Synonym Gene Names
CHP
UniProt Entry Name
CHP1_HUMAN

NCBI Description

This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]

Uniprot Description

CHP: Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na(+)/H(+) exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum- and GTPase-stimulated Na(+)/H(+) exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto- and substrate- phosphorylations in a calcium-dependent manner. Belongs to the calcineurin regulatory subunit family. CHP subfamily.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 15q13.3

Cellular Component: Golgi membrane; microtubule cytoskeleton; transport vesicle; focal adhesion; endoplasmic reticulum; cytoplasm; ER-Golgi intermediate compartment; plasma membrane; cytosol; nucleus

Molecular Function: protein binding; potassium channel regulator activity; protein kinase inhibitor activity; transporter activity; microtubule binding; calcium ion binding; kinase binding; calcium-dependent protein binding

Biological Process: glycosaminoglycan metabolic process; pathogenesis; negative regulation of protein import into nucleus; cytoplasmic microtubule organization and biogenesis; hyaluronan catabolic process; negative regulation of protein amino acid phosphorylation; positive regulation of protein amino acid glycosylation; small GTPase mediated signal transduction; negative regulation of protein amino acid autophosphorylation; protein export from nucleus; membrane docking; potassium ion transport; protein stabilization; transcytosis; protein oligomerization; calcium ion-dependent exocytosis; positive regulation of protein transport; inhibition of NF-kappaB transcription factor; carbohydrate metabolic process; regulation of intracellular pH; negative regulation of protein kinase activity; negative regulation of protein ubiquitination; positive regulation of sodium:hydrogen antiporter activity; hyaluronan metabolic process; microtubule bundle formation

Research Articles on CHP

Similar Products

Product Notes

The CHP chp1 (Catalog #AAA6373931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHP (Calcineurin B Homologous Protein 1, Calcineurin B-like Protein, Calcium-binding Protein CHP, Calcium-binding Protein p22, EF-hand Calcium-binding Domain-containing Protein p22, CHP1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHP chp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.