Rabbit anti-Human CHP Polyclonal Antibody | anti-CHP antibody

CHP (Calcineurin B Homologous Protein 1, Calcineurin B-like Protein, Calcium-binding Protein CHP, Calcium-binding Protein p22, EF-hand Calcium-binding Domain-containing Protein p22, CHP1) (Biotin)

Cat. Num. AAA6373930

• Gene Names: CHP1; CHP; p22; p24; Sid470p; SLC9A1BP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHP; Polyclonal Antibody; CHP (Calcineurin B Homologous Protein 1; Calcineurin B-like Protein; Calcium-binding Protein CHP; Calcium-binding Protein p22; EF-hand Calcium-binding Domain-containing Protein p22; CHP1) (Biotin); anti-CHP antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CHP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CHP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CHP, aa1-195 (NP_009167.1).
• Immunogen Sequence: MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CHP expression in transfected 293T cell line by CHP polyclonal antibody. Lane 1: CHP transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CHP antibody

Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na+/H+ exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum-and GTPase-stimulated Na+/H+ exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto-and substrate-phosphorylations in a calcium-dependent manner.

Product Categories/Family for anti-CHP antibody

Antibodies; Binding Proteins; Calcium

NCBI and Uniprot Product Information

• NCBI GI #: 6005731
• NCBI GeneID: 11261
• NCBI Accession #: NP_009167.1
• NCBI GenBank Nucleotide #: NM_007236
• UniProt Accession #: Q99653; Q6FHZ9; B2R6H9
• Molecular Weight: 22,456 Da
• NCBI Official Full Name: calcineurin B homologous protein 1
• NCBI Official Synonym Full Names: calcineurin-like EF-hand protein 1
• NCBI Official Symbol: CHP1
• NCBI Official Synonym Symbols: CHP; p22; p24; Sid470p; SLC9A1BP
• NCBI Protein Information: calcineurin B homologous protein 1; SLC9A1 binding protein; calcineurin B-like protein; calcium binding protein P22; calcium-binding protein CHP; calcium-binding protein p22; calcineurin homologous protein; calcineurin-like EF hand protein 1; EF-hand calc
• UniProt Protein Name: Calcineurin B homologous protein 1
• Protein Family: Chaoptin
• UniProt Gene Name: CHP1
• UniProt Synonym Gene Names: CHP
• UniProt Entry Name: CHP1_HUMAN

NCBI Description

This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]

Uniprot Description

CHP: Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na(+)/H(+) exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum- and GTPase-stimulated Na(+)/H(+) exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto- and substrate- phosphorylations in a calcium-dependent manner. Belongs to the calcineurin regulatory subunit family. CHP subfamily.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 15q13.3

Cellular Component: Golgi membrane; microtubule cytoskeleton; transport vesicle; focal adhesion; endoplasmic reticulum; cytoplasm; ER-Golgi intermediate compartment; plasma membrane; cytosol; nucleus

Molecular Function: protein binding; potassium channel regulator activity; protein kinase inhibitor activity; transporter activity; microtubule binding; calcium ion binding; kinase binding; calcium-dependent protein binding

Biological Process: glycosaminoglycan metabolic process; pathogenesis; negative regulation of protein import into nucleus; cytoplasmic microtubule organization and biogenesis; hyaluronan catabolic process; negative regulation of protein amino acid phosphorylation; positive regulation of protein amino acid glycosylation; small GTPase mediated signal transduction; negative regulation of protein amino acid autophosphorylation; protein export from nucleus; membrane docking; potassium ion transport; protein stabilization; transcytosis; protein oligomerization; calcium ion-dependent exocytosis; positive regulation of protein transport; inhibition of NF-kappaB transcription factor; carbohydrate metabolic process; regulation of intracellular pH; negative regulation of protein kinase activity; negative regulation of protein ubiquitination; positive regulation of sodium:hydrogen antiporter activity; hyaluronan metabolic process; microtubule bundle formation