Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Chondroadherin antibody (MBS5301783) used at 1 ug/ml to detect target protein.)

Rabbit Chondroadherin Polyclonal Antibody | anti-CHAD antibody

Chondroadherin antibody

Gene Names
CHAD; SLRR4A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Chondroadherin; Polyclonal Antibody; Chondroadherin antibody; Polyclonal Chondroadherin; Anti-Chondroadherin; CHAD; SLRR4A; anti-CHAD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Chondroadherin antibody was raised against the middle region of CHAD
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHAD antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
359
Applicable Applications for anti-CHAD antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Chondroadherin antibody (MBS5301783) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Chondroadherin antibody (MBS5301783) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CHAD antibody
Rabbit polyclonal Chondroadherin antibody raised against the middle region of CHAD
Product Categories/Family for anti-CHAD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38 kDa (MW of target protein)
NCBI Official Full Name
chondroadherin
NCBI Official Synonym Full Names
chondroadherin
NCBI Official Symbol
CHAD
NCBI Official Synonym Symbols
SLRR4A
NCBI Protein Information
chondroadherin
UniProt Protein Name
Chondroadherin
Protein Family
UniProt Gene Name
CHAD
UniProt Synonym Gene Names
SLRR4A
UniProt Entry Name
CHAD_HUMAN

NCBI Description

Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages. [provided by RefSeq, Jul 2008]

Uniprot Description

CHAD: Promotes attachment of chondrocytes, fibroblasts, and osteoblasts. This binding is mediated (at least for chondrocytes and fibroblasts) by the integrin alpha(2)beta(1). May play an important role in the regulation of chondrocyte growth and proliferation. Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class IV subfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q21.33

Cellular Component: proteinaceous extracellular matrix

Biological Process: cartilage condensation

Research Articles on CHAD

Similar Products

Product Notes

The CHAD chad (Catalog #AAA5301783) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Chondroadherin antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Chondroadherin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CHAD chad for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Chondroadherin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.