Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRKCB1 antibody (MBS5302352) used at 1 ug/ml to detect target protein.)

Rabbit PRKCB1 Polyclonal Antibody | anti-PRKCB1 antibody

PRKCB1 antibody

Gene Names
PRKCB; PKCB; PRKCB1; PRKCB2; PKC-beta
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
PRKCB1; Polyclonal Antibody; PRKCB1 antibody; Polyclonal PRKCB1; Anti-PRKCB1; PRKCB 1; Protein Kinase C Beta 1; PRKCB; PKCB; PKC-beta; PRKCB-1; PRKCB2; MGC41878; anti-PRKCB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
PRKCB1 antibody was raised against the N terminal of PRKCB1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKCB1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
542
Applicable Applications for anti-PRKCB1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PRKCB1 antibody (MBS5302352) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (PRKCB1 antibody (MBS5302352) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-PRKCB1 antibody
Rabbit polyclonal PRKCB1 antibody raised against the N terminal of PRKCB1
Product Categories/Family for anti-PRKCB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
77 kDa (MW of target protein)
NCBI Official Full Name
protein kinase C, beta 1, isoform CRA_c, partial
NCBI Official Synonym Full Names
protein kinase C, beta
NCBI Official Symbol
PRKCB
NCBI Official Synonym Symbols
PKCB; PRKCB1; PRKCB2; PKC-beta
NCBI Protein Information
protein kinase C beta type
UniProt Protein Name
Protein kinase C beta type
UniProt Gene Name
PRKCB
UniProt Synonym Gene Names
PKCB; PRKCB1; PKC-B; PKC-beta
UniProt Entry Name
KPCB_HUMAN

NCBI Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

PKCB: an AGC kinase of the PKC family. A classical PKC downstream of many mitogenic receptors. Activates the NF-kappaB signaling pathway in B cells after antigen-receptor signaling. Two splice-variant isoforms have been described.

Protein type: Kinase, protein; EC 2.7.11.13; Protein kinase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; Protein kinase, AGC; AGC group; PKC family; Alpha subfamily

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleoplasm; membrane; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; protein kinase C activity; androgen receptor binding; protein kinase C binding; ligand-dependent nuclear receptor transcription coactivator activity; zinc ion binding; histone binding; calcium channel regulator activity; chromatin binding; ATP binding

Biological Process: platelet activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; B cell activation; transcription, DNA-dependent; apoptosis; positive regulation of B cell receptor signaling pathway; mitotic nuclear envelope disassembly; negative regulation of insulin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; positive regulation of vascular endothelial growth factor receptor signaling pathway; activation of NF-kappaB transcription factor; regulation of transcription from RNA polymerase II promoter; cellular calcium ion homeostasis; synaptic transmission; B cell receptor signaling pathway; positive regulation of angiogenesis; lipoprotein transport; calcium ion transport; response to hypoxia; mitotic cell cycle; blood coagulation; vascular endothelial growth factor receptor signaling pathway

Research Articles on PRKCB1

Similar Products

Product Notes

The PRKCB1 prkcb (Catalog #AAA5302352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKCB1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the PRKCB1 prkcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKCB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.