Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CHAF1A Monoclonal Antibody | anti-CHAF1A antibody

CHAF1A (Chromatin Assembly Factor 1 Subunit A, CAF-1 Subunit A, Chromatin Assembly Factor I p150 Subunit, CAF-I 150kD Subunit, CAF-I p150, hp150, CAF, CAF1P150) (PE)

Gene Names
CHAF1A; CAF1; P150; CAF-1; CAF1B; CAF1P150
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHAF1A; Monoclonal Antibody; CHAF1A (Chromatin Assembly Factor 1 Subunit A; CAF-1 Subunit A; Chromatin Assembly Factor I p150 Subunit; CAF-I 150kD Subunit; CAF-I p150; hp150; CAF; CAF1P150) (PE); anti-CHAF1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C2
Specificity
Recognizes human CHAF1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CHAF1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-120 from CHAF1A (AAH67093) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(CHAF1A monoclonal antibody Western Blot analysis of CHAF1A expression in Hela NE)

Western Blot (WB) (CHAF1A monoclonal antibody Western Blot analysis of CHAF1A expression in Hela NE)

Testing Data

(Detection limit for recombinant GST tagged CHAF1A is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHAF1A is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-CHAF1A antibody
Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).
Product Categories/Family for anti-CHAF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
88,285 Da
NCBI Official Full Name
Homo sapiens chromatin assembly factor 1, subunit A (p150), mRNA
NCBI Official Synonym Full Names
chromatin assembly factor 1 subunit A
NCBI Official Symbol
CHAF1A
NCBI Official Synonym Symbols
CAF1; P150; CAF-1; CAF1B; CAF1P150
NCBI Protein Information
chromatin assembly factor 1 subunit A
Protein Family

NCBI Description

Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008]

Research Articles on CHAF1A

Similar Products

Product Notes

The CHAF1A (Catalog #AAA6157083) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHAF1A (Chromatin Assembly Factor 1 Subunit A, CAF-1 Subunit A, Chromatin Assembly Factor I p150 Subunit, CAF-I 150kD Subunit, CAF-I p150, hp150, CAF, CAF1P150) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHAF1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHAF1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHAF1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.