Rabbit CGAS Polyclonal Antibody | anti-CGAS antibody

CGAS Antibody - middle region

Cat. Num. AAA3210876

• Gene Names: CGAS; MB21D1; h-cGAS; C6orf150
• Reactivity: Cow, Guinea Pig, Horse, Human, Pig, Rabbit
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: CGAS; Polyclonal Antibody; CGAS Antibody - middle region; anti-CGAS antibody

• Host: Rabbit
• Reactivity: Cow, Guinea Pig, Horse, Human, Pig, Rabbit
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
• Sequence Length: 522

• Applicable Applications for anti-CGAS antibody: Western Blot (WB)
• Homology: Cow: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf150
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C6orf150Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB)

(Host: RabbitTarget Name: CGASSample Type: Fetal Liver lysatesAntibody Dilution: 0.2ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CGASSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CGASSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: MB21D1Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-CGAS antibody

This is a rabbit polyclonal antibody against C6orf150. It was validated on Western Blot using a cell lysate as a positive control.

Product Categories/Family for anti-CGAS antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 115511030
• NCBI GeneID: 115004
• NCBI Accession #: NP_612450
• NCBI GenBank Nucleotide #: NM_138441
• UniProt Accession #: Q8N884
• Molecular Weight: 59kDa
• NCBI Official Full Name: cyclic GMP-AMP synthase
• NCBI Official Synonym Full Names: cyclic GMP-AMP synthase
• NCBI Official Symbol: CGAS
• NCBI Official Synonym Symbols: MB21D1; h-cGAS; C6orf150
• NCBI Protein Information: cyclic GMP-AMP synthase
• UniProt Protein Name: Cyclic GMP-AMP synthase
• UniProt Gene Name: MB21D1
• UniProt Synonym Gene Names: C6orf150; cGAMP synthase; cGAS; h-cGAS
• UniProt Entry Name: CGAS_HUMAN

Uniprot Description

MB21D1: Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP. Catalysis involves both the formation of a 2',5' phosphodiester linkage at the GpA step and the formation of a 3',5' phosphodiester linkage at the ApG step, producing c[G(2',5')pA(3',5')p]. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of double-stranded DNA (dsDNA) in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production.

Protein type: Enzyme, cellular metabolism; EC 2.7.7.86

Chromosomal Location of Human Ortholog: 6q13

Cellular Component: cytosol

Molecular Function: ATP binding; DNA binding; GTP binding; metal ion binding

Biological Process: activation of innate immune response; cyclic nucleotide biosynthetic process; defense response to virus; innate immune response; positive regulation of defense response to virus by host; positive regulation of interferon type I production