Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCDC11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Rabbit CFAP53 Polyclonal Antibody | anti-CFAP53 antibody

CFAP53 Antibody - N-terminal region

Gene Names
CFAP53; HTX6; CCDC11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CFAP53; Polyclonal Antibody; CFAP53 Antibody - N-terminal region; anti-CFAP53 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Sequence Length
514
Applicable Applications for anti-CFAP53 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCDC11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-CCDC11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-CFAP53 antibody
This is a rabbit polyclonal antibody against CCDC11. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning.
Product Categories/Family for anti-CFAP53 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
cilia- and flagella-associated protein 53
NCBI Official Synonym Full Names
cilia and flagella associated protein 53
NCBI Official Symbol
CFAP53
NCBI Official Synonym Symbols
HTX6; CCDC11
NCBI Protein Information
cilia- and flagella-associated protein 53
UniProt Protein Name
Cilia- and flagella-associated protein 53
UniProt Gene Name
CFAP53
UniProt Entry Name
CFA53_HUMAN

NCBI Description

This gene belongs to the CFAP53 family. It was found to be differentially expressed by the ciliated cells of frog epidermis and in skin fibroblasts from human. Mutations in this gene are associated with visceral heterotaxy-6, which implicates this gene in determination of left-right asymmetric patterning. [provided by RefSeq, Aug 2015]

Uniprot Description

CCDC11: Defects in CCDC11 are the cause of heterotaxy, visceral, type 6, autosomal (HTX6). A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. HTX6 clinical features are situs inversus totalis and severe complex cardiac malformations including unbalanced atrioventricular canal defects, transposition of the great arteries with severe pulmonary stenosis, right aortic arch, abnormal systemic venous return and total anomalous pulmonary venous drainage.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: cilium

Disease: Heterotaxy, Visceral, 6, Autosomal

Research Articles on CFAP53

Similar Products

Product Notes

The CFAP53 cfap53 (Catalog #AAA3212233) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CFAP53 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CFAP53 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CFAP53 cfap53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSQRFGTVQR EVKGPTPKVV IVRSKPPKGQ GAEHHLERIR RSHQKHNAIL. It is sometimes possible for the material contained within the vial of "CFAP53, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.