Western Blot (WB)
(Host: RabbitTarget Name: CEP97Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human CEP97 Polyclonal Antibody | anti-CEP97 antibody
CEP97 Antibody - middle region
Gene Names
CEP97; LRRIQ2; 2810403B08Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CEP97; Polyclonal Antibody; CEP97 Antibody - middle region; anti-CEP97 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDQLFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMP
Sequence Length
865
Applicable Applications for anti-CEP97 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CEP97
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CEP97Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CEP97Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CEP97 antibody
Acts as a key negative regulator of ciliogenesis in collaboration with CCP110 by capping the mother centriole thereby preventing cilia formation. Required for recruitment of CCP110 to the centrosome.
Product Categories/Family for anti-CEP97 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95 kDa
NCBI Official Full Name
centrosomal protein of 97 kDa isoform 1
NCBI Official Synonym Full Names
centrosomal protein 97
NCBI Official Symbol
CEP97
NCBI Official Synonym Symbols
LRRIQ2; 2810403B08Rik
NCBI Protein Information
centrosomal protein of 97 kDa
UniProt Protein Name
Centrosomal protein of 97 kDa
Protein Family
UniProt Gene Name
CEP97
UniProt Synonym Gene Names
LRRIQ2; Cep97
UniProt Entry Name
CEP97_HUMAN
Uniprot Description
LRRIQ2: Collaborates with CCP110, being involved in the suppression of a cilia assembly program. Required for correct spindle formation and has a role in cytokinesis. Required for recruitment of CCP110 to the centrosome. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 3q12.3
Cellular Component: centrosome; protein complex; cytoplasm; microtubule organizing center; cytosol
Molecular Function: calmodulin binding; protein binding
Biological Process: cell projection organization and biogenesis; organelle organization and biogenesis
Similar Products
Product Notes
The CEP97 cep97 (Catalog #AAA3222003) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEP97 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEP97 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEP97 cep97 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDQLFAVKNN FPASVHTTRY SRNDLHLEDI QTDEDKLNCS LLSSESTFMP. It is sometimes possible for the material contained within the vial of "CEP97, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
