Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CENPP rabbit polyclonal antibody. Western Blot analysis of CENPP expression in mouse liver.)

Rabbit anti-Human, Mouse CENPP Polyclonal Antibody | anti-CENPP antibody

CENPP (Centromere Protein P, CENP-P, FLJ33928) (FITC)

Gene Names
CENPP; CENP-P
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CENPP; Polyclonal Antibody; CENPP (Centromere Protein P; CENP-P; FLJ33928) (FITC); anti-CENPP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CENPP. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CENPP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CENPP, aa1-288 (NP_001012267.1).
Immunogen Sequence
MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CENPP rabbit polyclonal antibody. Western Blot analysis of CENPP expression in mouse liver.)

Western Blot (WB) (CENPP rabbit polyclonal antibody. Western Blot analysis of CENPP expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of CENPP expression in transfected 293T cell line by CENPP polyclonal antibody. Lane 1: CENPP transfected lysate (33.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CENPP expression in transfected 293T cell line by CENPP polyclonal antibody. Lane 1: CENPP transfected lysate (33.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CENPP antibody
Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
Product Categories/Family for anti-CENPP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,707 Da
NCBI Official Full Name
centromere protein P isoform a
NCBI Official Synonym Full Names
centromere protein P
NCBI Official Symbol
CENPP
NCBI Official Synonym Symbols
CENP-P
NCBI Protein Information
centromere protein P
UniProt Protein Name
Centromere protein P
Protein Family
UniProt Gene Name
CENPP
UniProt Synonym Gene Names
CENP-P
UniProt Entry Name
CENPP_HUMAN

NCBI Description

CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM, Mar 2008]

Uniprot Description

CENPP: Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Chromosomal Location of Human Ortholog: 9q22.31

Cellular Component: nucleoplasm; cytosol; chromosome, pericentric region

Biological Process: nucleosome assembly; DNA replication-independent nucleosome assembly at centromere; mitotic cell cycle

Research Articles on CENPP

Similar Products

Product Notes

The CENPP cenpp (Catalog #AAA6373689) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENPP (Centromere Protein P, CENP-P, FLJ33928) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CENPP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CENPP cenpp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CENPP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.