Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CENPB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: Jurkat cell lysate)

Rabbit CENPB Polyclonal Antibody | anti-CENPB antibody

CENPB antibody - C-terminal region

Reactivity
Cow, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CENPB; Polyclonal Antibody; CENPB antibody - C-terminal region; anti-CENPB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK
Sequence Length
599
Applicable Applications for anti-CENPB antibody
Western Blot (WB)
Homology
Cow: 83%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 100%; Sheep: 86%; Yeast: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CENPB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CENPB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CENPB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CENPB antibody
This is a rabbit polyclonal antibody against CENPB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CENPB is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies.This gene product is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. The DNA binding domain recognizes and binds a 17-bp sequence (CENP-B box) in the centromeric alpha satellite DNA. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
major centromere autoantigen B
NCBI Official Synonym Full Names
centromere protein B
NCBI Official Symbol
CENPB
NCBI Protein Information
major centromere autoantigen B
UniProt Protein Name
Major centromere autoantigen B
UniProt Gene Name
CENPB
UniProt Synonym Gene Names
CENP-B
UniProt Entry Name
CENPB_HUMAN

NCBI Description

This gene product is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. The DNA binding domain recognizes and binds a 17-bp sequence (CENP-B box) in the centromeric alpha satellite DNA. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognized by sera from patients with anti-centromere antibodies. [provided by RefSeq, Jul 2008]

Uniprot Description

CENPB: Interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. May organize arrays of centromere satellite DNA into a higher-order structure which then directs centromere formation and kinetochore assembly in mammalian chromosomes.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: chromosome; nucleus; chromosome, pericentric region

Molecular Function: centromeric DNA binding; sequence-specific DNA binding; satellite DNA binding; chromatin binding

Biological Process: regulation of transcription, DNA-dependent

Research Articles on CENPB

Similar Products

Product Notes

The CENPB cenpb (Catalog #AAA3210538) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENPB antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CENPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CENPB cenpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGEDSDSDSE EEDDEEEDDE DEDDDDDEED GDEVPVPSFG EAMAYFAMVK. It is sometimes possible for the material contained within the vial of "CENPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.