Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-REL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Rabbit REL Polyclonal Antibody | anti-REL antibody

REL antibody - middle region

Gene Names
REL; C-Rel
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
REL; Polyclonal Antibody; REL antibody - middle region; anti-REL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQ
Sequence Length
619
Applicable Applications for anti-REL antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 77%; Horse: 85%; Human: 100%; Pig: 93%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human REL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-REL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-REL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-REL antibody
This is a rabbit polyclonal antibody against REL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: REL is a member of the Rel/NFKB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain,' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor. The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA (MIM 164014), RELB (604758), NFKB1 (MIM 164011), and NFKB2 (MIM 164012). These proteins are related through a highly conserved N-terminal region termed the 'Rel domain,' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (MIM 164008) (Belguise and Sonenshein, 2007 [PubMed 18037997]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-174 CN414487.1 2-175 175-2323 X75042.1 128-2276 2324-2457 BX111941.1 575-708 2458-2592 AA279919.1 1-135 c

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
proto-oncogene c-Rel isoform 1
NCBI Official Synonym Full Names
REL proto-oncogene, NF-kB subunit
NCBI Official Symbol
REL
NCBI Official Synonym Symbols
C-Rel
NCBI Protein Information
proto-oncogene c-Rel
UniProt Protein Name
Proto-oncogene c-Rel
Protein Family
UniProt Gene Name
REL
UniProt Entry Name
REL_HUMAN

NCBI Description

This gene encodes a protein that belongs to the Rel homology domain/immunoglobulin-like fold, plexin, transcription factor (RHD/IPT) family. Members of this family regulate genes involved in apoptosis, inflammation, the immune response, and oncogenic processes. This proto-oncogene plays a role in the survival and proliferation of B lymphocytes. Mutation or amplification of this gene is associated with B-cell lymphomas, including Hodgkin's lymphoma. Single nucleotide polymorphisms in this gene are associated with susceptibility to ulcerative colitis and rheumatoid arthritis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]

Uniprot Description

REL: a proto-oncogenic transcription factor of the nuclear factor-kappaB (NFkB) group. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. May play a role in differentiation and lymphopoiesis.

Protein type: Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 2p13-p12

Cellular Component: nucleoplasm; transcription factor complex; cytosol

Molecular Function: protein binding; chromatin binding; transcription factor activity

Biological Process: I-kappaB kinase/NF-kappaB cascade; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-12 biosynthetic process; transcription, DNA-dependent; response to cytokine stimulus; cytokine production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; inflammatory response

Research Articles on REL

Similar Products

Product Notes

The REL rel (Catalog #AAA3203955) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REL antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's REL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the REL rel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CADNSMINES GPSNSTNPNS HGFVQDSQYS GIGSMQNEQL SDSFPYEFFQ. It is sometimes possible for the material contained within the vial of "REL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.