Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG polyclonal antibody. Lane 1: CEBPG transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CEBPG Polyclonal Antibody | anti-CEBPG antibody

CEBPG (CCAAT/Enhancer-binding Protein gamma, C/EBP gamma) (FITC)

Gene Names
CEBPG; GPE1BP; IG/EBP-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CEBPG; Polyclonal Antibody; CEBPG (CCAAT/Enhancer-binding Protein gamma; C/EBP gamma) (FITC); anti-CEBPG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CEBPG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CEBPG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CEBPG, aa1-150 (NP_001797.1).
Immunogen Sequence
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG polyclonal antibody. Lane 1: CEBPG transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG polyclonal antibody. Lane 1: CEBPG transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CEBPG antibody
Transcription factor that binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit them to unusual DNA sites.
Product Categories/Family for anti-CEBPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,408 Da
NCBI Official Full Name
CCAAT/enhancer-binding protein gamma
NCBI Official Synonym Full Names
CCAAT/enhancer binding protein (C/EBP), gamma
NCBI Official Symbol
CEBPG
NCBI Official Synonym Symbols
GPE1BP; IG/EBP-1
NCBI Protein Information
CCAAT/enhancer-binding protein gamma; c/EBP gamma
UniProt Protein Name
CCAAT/enhancer-binding protein gamma
UniProt Gene Name
CEBPG
UniProt Synonym Gene Names
C/EBP gamma
UniProt Entry Name
CEBPG_HUMAN

NCBI Description

The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

C/EBP-gamma: Transcription factor that binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit them to unusual DNA sites. Belongs to the bZIP family. C/EBP subfamily.

Protein type: Transcription factor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.11

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; double-stranded DNA binding; transcription factor binding

Biological Process: positive regulation of DNA repair; transcription, DNA-dependent; natural killer cell mediated cytotoxicity; negative regulation of transcription factor activity; enucleate erythrocyte differentiation; liver development; mRNA metabolic process; regulation of transcription from RNA polymerase II promoter; B cell differentiation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of interferon-gamma biosynthetic process; positive regulation of DNA binding

Research Articles on CEBPG

Similar Products

Product Notes

The CEBPG cebpg (Catalog #AAA6373612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEBPG (CCAAT/Enhancer-binding Protein gamma, C/EBP gamma) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEBPG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CEBPG cebpg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEBPG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.