Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CEBPBSample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CEBPB Polyclonal Antibody | anti-CEBPB antibody

CEBPB Antibody - middle region

Gene Names
CEBPB; TCF5; IL6DBP; NF-IL6; C/EBP-beta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CEBPB; Polyclonal Antibody; CEBPB Antibody - middle region; anti-CEBPB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAP
Sequence Length
345
Applicable Applications for anti-CEBPB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CEBPB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CEBPBSample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CEBPBSample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CEBPB antibody
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Product Categories/Family for anti-CEBPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
CCAAT/enhancer-binding protein beta isoform b
NCBI Official Synonym Full Names
CCAAT enhancer binding protein beta
NCBI Official Symbol
CEBPB
NCBI Official Synonym Symbols
TCF5; IL6DBP; NF-IL6; C/EBP-beta
NCBI Protein Information
CCAAT/enhancer-binding protein beta
UniProt Protein Name
CCAAT/enhancer-binding protein beta
UniProt Gene Name
CEBPB
UniProt Synonym Gene Names
LAP; TCF5; C/EBP beta; TCF-5
UniProt Entry Name
CEBPB_HUMAN

NCBI Description

This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013]

Uniprot Description

C/EBP-beta: a bZIP transcription factor which can form homodimers or heterodimers with the related proteins CEBP-alpha, -delta and -gamma. Involved in immune and inflammatory responses. Specifically binds to regulatory regions of genes encoding IL-6, other cytokines and several acute-phase proteins. There are two forms of C/EBPbeta, the 38kDa liver activating protein (LAP) and the 20kDa liver inhibitory protein (LIP) which may be products of alternative translation. LAP is a transcriptional activator while LIP may inhibit C/EBPbeta transcriptional activity. Phosphorylated and activated by ERK1/2.

Protein type: Motility/polarity/chemotaxis; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 20q13.1

Cellular Component: nucleoplasm; nuclear matrix; nuclear chromatin; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; chromatin binding; transcription factor activity; transcription factor binding; glucocorticoid receptor binding

Biological Process: transcription from RNA polymerase II promoter; embryonic placenta development; regulation of interleukin-6 biosynthetic process; mammary gland epithelial cell proliferation; response to lipopolysaccharide; neuron differentiation; positive regulation of osteoblast differentiation; regulation of transcription, DNA-dependent; brown fat cell differentiation; acute-phase response; positive regulation of fat cell differentiation; immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of neuron apoptosis; inflammatory response; negative regulation of transcription, DNA-dependent

Research Articles on CEBPB

Similar Products

Product Notes

The CEBPB cebpb (Catalog #AAA3223021) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEBPB Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEBPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEBPB cebpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGAGMAAGFP YALRAYLGYQ AVPSGSSGSL STSSSSSPPG TPSPADAKAP. It is sometimes possible for the material contained within the vial of "CEBPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.