Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CEACAM16 antibody (MBS5302095) used at 1 ug/ml to detect target protein.)

Rabbit CEACAM16 Polyclonal Antibody | anti-CEACAM16 antibody

CEACAM16 antibody

Gene Names
CEACAM16; CEAL2; DFNA4B
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CEACAM16; Polyclonal Antibody; CEACAM16 antibody; Polyclonal CEACAM16; Anti-CEACAM16; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16; CEAL2; anti-CEACAM16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
CEACAM16 antibody was raised against the middle region of CEACAM16
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEACAM16 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
425
Applicable Applications for anti-CEACAM16 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(CEACAM16 antibody (MBS5302095) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (CEACAM16 antibody (MBS5302095) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CEACAM16 antibody
Rabbit polyclonal CEACAM16 antibody raised against the middle region of CEACAM16
Product Categories/Family for anti-CEACAM16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53 kDa (MW of target protein)
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 16
NCBI Official Synonym Full Names
carcinoembryonic antigen-related cell adhesion molecule 16
NCBI Official Symbol
CEACAM16
NCBI Official Synonym Symbols
CEAL2; DFNA4B
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 16
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 16
UniProt Gene Name
CEACAM16
UniProt Synonym Gene Names
CEAL2
UniProt Entry Name
CEA16_HUMAN

NCBI Description

The protein encoded by this gene is a secreted glycoprotein that in mouse interacts with tectorial membrane proteins in the inner ear. The encoded adhesion protein is found in cochlear outer hair cells and appears to be important for proper hearing over an extended frequency range. Defects in this gene likely are a cause of non-syndromic autosomal dominant hearing loss. [provided by RefSeq, May 2012]

Uniprot Description

CEACAM16: May play a role in maintaining the integrity of the tectorial membrane. Defects in CEACAM16 are the cause of deafness autosomal dominant type 4B (DFNA4B). A form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the immunoglobulin superfamily. CEA family.

Protein type: Secreted, signal peptide; Secreted; Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: extracellular region; stereocilium bundle tip

Biological Process: sensory perception of sound

Disease: Deafness, Autosomal Dominant 4b

Research Articles on CEACAM16

Similar Products

Product Notes

The CEACAM16 ceacam16 (Catalog #AAA5302095) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEACAM16 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CEACAM16 ceacam16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEACAM16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.