UTP--glucose-1-phosphate uridylyltransferase Recombinant Protein | UGP2 recombinant protein

Recombinant Human UTP--glucose-1-phosphate uridylyltransferase

Cat. Num. AAA1475105

• Gene Names: UGP2; UDPG; UGP1; UDPGP; UGPP1; UGPP2; UDPGP2; pHC379
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: UTP--glucose-1-phosphate uridylyltransferase; Recombinant Human UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; UGP2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-497aa; Full Length of Isoform 2
• Sequence: MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
• Sequence Length: 497

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for UGP2 recombinant protein

Plays a central role as a glucosyl donor in cellular metabolic pathways.

Product Categories/Family for UGP2 recombinant protein

Cancer

References

Cloning of a human liver UDP-glucose pyrophosphorylase cDNA by complementation of the bacterial galU mutation.Peng H.-L., Chang H.-Y.FEBS Lett. 329:153-158(1993) Sequence differences between human muscle and liver cDNAs for UDPglucose pyrophosphorylase and kinetic properties of the recombinant enzymes expressed in Escherichia coli.Duggleby R.G., Chao Y.C., Huang J.G., Peng H.-L., Chang H.-Y.Eur. J. Biochem. 235:173-179(1996) The importance of conserved residues in human liver UDPglucose pyrophosphorylase.Chang H.-Y., Peng H.-L., Chao Y.C., Duggleby R.G.Eur. J. Biochem. 236:723-728(1996) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity.Yu Q., Zheng X.Biochem. J. 442:283-291(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 48255968
• NCBI GeneID: 7360
• NCBI Accession #: NP_001001521.1
• NCBI GenBank Nucleotide #: NM_001001521.1
• UniProt Accession #: Q16851; Q07131; Q0P6K2; Q86Y81; Q9BU15
• Molecular Weight: 71.7 kDa
• NCBI Official Full Name: UTP--glucose-1-phosphate uridylyltransferase isoform b
• NCBI Official Synonym Full Names: UDP-glucose pyrophosphorylase 2
• NCBI Official Symbol: UGP2
• NCBI Official Synonym Symbols: UDPG; UGP1; UDPGP; UGPP1; UGPP2; UDPGP2; pHC379
• NCBI Protein Information: UTP--glucose-1-phosphate uridylyltransferase
• UniProt Protein Name: UTP--glucose-1-phosphate uridylyltransferase
• Protein Family: UTP--glucose-1-phosphate uridylyltransferase
• UniProt Gene Name: UGP2
• UniProt Synonym Gene Names: UGP1; UDPGP; UGPase
• UniProt Entry Name: UGPA_HUMAN

NCBI Description

The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UGP2: Plays a central role as a glucosyl donor in cellular metabolic pathways. Belongs to the UDPGP type 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.7.9; Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - pentose and glucuronate interconversions; Transferase; Carbohydrate Metabolism - starch and sucrose; Carbohydrate Metabolism - amino sugar and nucleotide sugar

Chromosomal Location of Human Ortholog: 2p14-p13

Cellular Component: cytosol; nucleus

Molecular Function: glucose binding; identical protein binding; metal ion binding; protein binding; pyrimidine ribonucleotide binding; UTP:glucose-1-phosphate uridylyltransferase activity

Biological Process: carbohydrate metabolic process; glucose 1-phosphate metabolic process; glucose metabolic process; glycogen biosynthetic process; UDP-glucose metabolic process; UDP-glucuronate biosynthetic process; xenobiotic metabolic process