Mouse anti-Human PAX2 Monoclonal Antibody | anti-PAX2 antibody

PAX2 (Paired Box Protein Pax-2) (PE)

Cat. Num. AAA6159289

• Gene Names: PAX2; FSGS7; PAPRS
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAX2; Monoclonal Antibody; PAX2 (Paired Box Protein Pax-2) (PE); anti-PAX2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C7
• Specificity: Recognizes human PAX2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-PAX2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 0.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa194-304 of human PAX2 (NP_000269) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody. Lane 1: PAX2 transfected lysate (47.41kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunohistochemical staining of PAX2 in formalin-fixed paraffin-embedded human adrenal gland using antibody concentration at 0.5ug/ml. Detection: Immunoperoxidase method.)

Product Categories/Family for anti-PAX2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1003701522
• NCBI GeneID: 5076
• NCBI Accession #: NP_000269
• NCBI GenBank Nucleotide #: NM_000278
• UniProt Accession #: Q02962
• Molecular Weight: 42kDa
• NCBI Official Full Name: paired box protein Pax-2 isoform b
• NCBI Official Synonym Full Names: paired box 2
• NCBI Official Symbol: PAX2
• NCBI Official Synonym Symbols: FSGS7; PAPRS
• NCBI Protein Information: paired box protein Pax-2
• UniProt Protein Name: Paired box protein Pax-2
• Protein Family: Paired box protein
• UniProt Gene Name: PAX2
• UniProt Entry Name: PAX2_HUMAN

NCBI Description

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

PAX2: Probable transcription factor that may have a role in kidney cell differentiation. Has a critical role in the development of the urogenital tract, the eyes, and the CNS. Interacts with ELGN3; the interaction targets PAX2 for destruction. Expressed in primitive cells of the kidney, ureter, eye, ear and central nervous system. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: protein complex; lysosome; microtubule organizing center; nucleus

Molecular Function: protein binding; DNA binding; superoxide-generating NADPH oxidase activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of cytolysis; optic nerve structural organization; positive regulation of transcription, DNA-dependent; cell fate determination; negative regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; pronephros development; glial cell differentiation; vestibulocochlear nerve formation; visual perception; pancreas development; negative regulation of programmed cell death; protein kinase B signaling cascade; brain morphogenesis; mesonephros development; aging; response to nutrient levels; inner ear morphogenesis; camera-type eye development; transcription, DNA-dependent; optic cup morphogenesis involved in camera-type eye development; stem cell differentiation; optic nerve morphogenesis; axonogenesis; optic nerve development; ureteric bud branching; neural tube closure; mesodermal cell fate specification; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; urogenital system development; positive regulation of epithelial cell proliferation; negative regulation of apoptosis

Disease: Papillorenal Syndrome; Renal Hypodysplasia/aplasia 1; Focal Segmental Glomerulosclerosis 7