Rabbit anti-Human CDK6 Polyclonal Antibody | anti-CDK6 antibody

CDK6 Antibody - middle region

Cat. Num. AAA3223037

• Gene Names: CDK6; MCPH12; PLSTIRE
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: CDK6; Polyclonal Antibody; CDK6 Antibody - middle region; anti-CDK6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELG
• Sequence Length: 326

• Applicable Applications for anti-CDK6 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CDK6
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDK6Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-CDK6 antibody

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Expression of this gene is up-regulated in some types of cancer. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Product Categories/Family for anti-CDK6 antibody

Polyclonal; Cancer; Cell Cycle Proteins; Signaling Intermediate; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 223718134
• NCBI GeneID: 1021
• NCBI Accession #: NP_001138778.1
• NCBI GenBank Nucleotide #: NM_001145306.1
• UniProt Accession #: Q00534
• Molecular Weight: 35 kDa
• NCBI Official Full Name: cyclin-dependent kinase 6
• NCBI Official Synonym Full Names: cyclin dependent kinase 6
• NCBI Official Symbol: CDK6
• NCBI Official Synonym Symbols: MCPH12; PLSTIRE
• NCBI Protein Information: cyclin-dependent kinase 6
• UniProt Protein Name: Cyclin-dependent kinase 6
• Protein Family: Cyclin-dependent kinase
• UniProt Gene Name: CDK6
• UniProt Synonym Gene Names: CDKN6
• UniProt Entry Name: CDK6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. [provided by RefSeq, Aug 2017]