Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDK5RAP3Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDK5RAP3 Polyclonal Antibody | anti-CDK5RAP3 antibody

CDK5RAP3 Antibody - middle region

Gene Names
CDK5RAP3; C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDK5RAP3; Polyclonal Antibody; CDK5RAP3 Antibody - middle region; anti-CDK5RAP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITV
Sequence Length
531
Applicable Applications for anti-CDK5RAP3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDK5RAP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDK5RAP3Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDK5RAP3Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDK5RAP3 antibody
This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.
Product Categories/Family for anti-CDK5RAP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
CDK5 regulatory subunit-associated protein 3 isoform d
NCBI Official Synonym Full Names
CDK5 regulatory subunit associated protein 3
NCBI Official Symbol
CDK5RAP3
NCBI Official Synonym Symbols
C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
NCBI Protein Information
CDK5 regulatory subunit-associated protein 3
UniProt Protein Name
CDK5 regulatory subunit-associated protein 3
Protein Family
UniProt Gene Name
CDK5RAP3
UniProt Synonym Gene Names
IC53
UniProt Entry Name
CK5P3_HUMAN

NCBI Description

This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

CDK5RAP3: Potential regulator of CDK5 activity. May be involved in cell proliferation. Regulates CDK5 activity via its interaction with CDK5R1. Belongs to the CDK5RAP3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: protein complex; membrane; cytoplasm; nucleolus; endomembrane system; nucleus

Molecular Function: cyclin binding; protein binding; protein kinase binding

Biological Process: cell proliferation; positive regulation of protein ubiquitination; inhibition of NF-kappaB transcription factor; regulation of neuron differentiation; regulation of mitotic cell cycle; positive regulation of transcription from RNA polymerase II promoter; brain development; regulation of cyclin-dependent protein kinase activity

Research Articles on CDK5RAP3

Similar Products

Product Notes

The CDK5RAP3 cdk5rap3 (Catalog #AAA3221904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK5RAP3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5RAP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK5RAP3 cdk5rap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEAVSEGTDS GISAEAAGID WGIFPESDSK DPGGDGIDWG DDAVALQITV. It is sometimes possible for the material contained within the vial of "CDK5RAP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.