Western Blot (WB)
(Host: RabbitTarget Name: CDK5RAP3Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human CDK5RAP3 Polyclonal Antibody | anti-CDK5RAP3 antibody
CDK5RAP3 Antibody - C-terminal region
Gene Names
CDK5RAP3; C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDK5RAP3; Polyclonal Antibody; CDK5RAP3 Antibody - C-terminal region; anti-CDK5RAP3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA
Sequence Length
531
Applicable Applications for anti-CDK5RAP3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CDK5RAP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CDK5RAP3Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CDK5RAP3Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDK5RAP3 antibody
This is a rabbit polyclonal antibody against CDK5RAP3. It was validated on Western Blot
Target Description: This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.
Target Description: This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.
Product Categories/Family for anti-CDK5RAP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58kDa
NCBI Official Full Name
CDK5 regulatory subunit-associated protein 3 isoform c
NCBI Official Synonym Full Names
CDK5 regulatory subunit associated protein 3
NCBI Official Symbol
CDK5RAP3
NCBI Official Synonym Symbols
C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
NCBI Protein Information
CDK5 regulatory subunit-associated protein 3
Protein Family
NCBI Description
This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013]
Research Articles on CDK5RAP3
Similar Products
Product Notes
The CDK5RAP3 (Catalog #AAA3215421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK5RAP3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5RAP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK5RAP3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDWGDFGVEA VSEGTDSGIS AEAAGIDWGI FPESDSKDPG GDGIDWGDDA. It is sometimes possible for the material contained within the vial of "CDK5RAP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
