Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Rabbit anti-Human CD5 Polyclonal Antibody | anti-CD5 antibody

CD5 antibody - N-terminal region

Gene Names
CD5; T1; LEU1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD5; Polyclonal Antibody; CD5 antibody - N-terminal region; anti-CD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
Sequence Length
495
Applicable Applications for anti-CD5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-CD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)
Related Product Information for anti-CD5 antibody
This is a rabbit polyclonal antibody against CD5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
Product Categories/Family for anti-CD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
921
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
T-cell surface glycoprotein CD5 isoform 1
NCBI Official Synonym Full Names
CD5 molecule
NCBI Official Symbol
CD5
NCBI Official Synonym Symbols
T1; LEU1
NCBI Protein Information
T-cell surface glycoprotein CD5
UniProt Protein Name
T-cell surface glycoprotein CD5
Protein Family
UniProt Gene Name
CD5
UniProt Synonym Gene Names
LEU1
UniProt Entry Name
CD5_HUMAN

NCBI Description

This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2016]

Uniprot Description

CD5: a surface glycoprotein expressed on T cells and B-1 B cells. Rapidly recruited to the immunological synapse, lowering the response of the T cell antigen receptor. CD5 interacts with CD72/LYB-2. Promotes B-cell survival through stimulation of autocrine IL-10 production. Contains 3 SRCR domains.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; cell proliferation; T cell costimulation; cell recognition

Research Articles on CD5

Similar Products

Product Notes

The CD5 cd5 (Catalog #AAA3213892) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD5 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD5 cd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPMGSLQPLA TLYLLGMLVA SCLGRLSWYD PDFQARLTRS NSKCQGQLEV. It is sometimes possible for the material contained within the vial of "CD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.