Immunohistochemistry (IHC)
(Sample Type :Human kidney Primary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution :1:5000Color/Signal Descriptions :Brown: CD34 Blue: DAPI Gene Name :CD34Submitted by :Christina Theodorpoulos, Queensland Univ. of Technology)
Rabbit CD34 Polyclonal Antibody | anti-CD34 antibody
CD34 antibody - C-terminal region
Reactivity
Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CD34; Polyclonal Antibody; CD34 antibody - C-terminal region; anti-CD34 antibody
Host
Rabbit
Reactivity
Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR
Sequence Length
328
Applicable Applications for anti-CD34 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 86%; Goat: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CD34
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type :Human kidney Primary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution :1:5000Color/Signal Descriptions :Brown: CD34 Blue: DAPI Gene Name :CD34Submitted by :Christina Theodorpoulos, Queensland Univ. of Technology)
Immunohistochemistry (IHC)
(Sample Type :Human kidney Primary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution :1:5000Color/Signal Descriptions :Brown: CD34 Blue: DAPI Gene Name :CD34Submitted by :Christina Theodorpoulos, Queensland Univ. of Technology)
Related Product Information for anti-CD34 antibody
This is a rabbit polyclonal antibody against CD34. It was validated on Western Blot
Target Description: CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells.
Target Description: CD34 is a monomeric cell surface antigen with a molecular mass of approximately 110 kD that is selectively expressed on human hematopoietic progenitor cells.
Product Categories/Family for anti-CD34 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kDa
NCBI Official Full Name
hematopoietic progenitor cell antigen CD34 isoform b
NCBI Official Synonym Full Names
CD34 molecule
NCBI Official Symbol
CD34
NCBI Protein Information
hematopoietic progenitor cell antigen CD34
UniProt Protein Name
CD34 antigen
Protein Family
UniProt Gene Name
CD34
UniProt Entry Name
Q3C1E7_HUMAN
NCBI Description
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Research Articles on CD34
Similar Products
Product Notes
The CD34 cd34 (Catalog #AAA3215044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD34 antibody - C-terminal region reacts with Dog, Goat, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD34 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CD34 cd34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLKKLGILDF TEQDVASHQS YSQKTLIALV TSGALLAVLG ITGYFLMNRR. It is sometimes possible for the material contained within the vial of "CD34, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
