Rabbit CD1E Polyclonal Antibody | anti-CD1E antibody

CD1E Antibody - C-terminal region

Cat. Num. AAA3216016

• Gene Names: CD1E; R2; CD1A
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: CD1E; Polyclonal Antibody; CD1E Antibody - C-terminal region; anti-CD1E antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
• Sequence Length: 290

• Applicable Applications for anti-CD1E antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%; Sheep: 79%
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD1E
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD1ESample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-CD1E antibody

This is a rabbit polyclonal antibody against CD1E. It was validated on Western Blot

Target Description: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined.

Product Categories/Family for anti-CD1E antibody

Polyclonal; Membrane Protein; Cell Biology; Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 110618230
• NCBI GeneID: 913
• NCBI Accession #: NP_001036048.1
• NCBI GenBank Nucleotide #: NM_001042583.2
• UniProt Accession #: P15812
• Molecular Weight: 31kDa
• NCBI Official Full Name: T-cell surface glycoprotein CD1e, membrane-associated isoform b
• NCBI Official Synonym Full Names: CD1e molecule
• NCBI Official Symbol: CD1E
• NCBI Official Synonym Symbols: R2; CD1A
• NCBI Protein Information: T-cell surface glycoprotein CD1e, membrane-associated
• UniProt Protein Name: T-cell surface glycoprotein CD1e, membrane-associated
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD1E
• UniProt Synonym Gene Names: hCD1e; sCD1e
• UniProt Entry Name: CD1E_HUMAN

NCBI Description

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined. [provided by RefSeq, Jun 2010]

Uniprot Description

CD1E: T-cell surface glycoprotein CD1e, soluble is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. 12 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: Golgi membrane; lysosomal lumen; integral to plasma membrane; late endosome; early endosome; plasma membrane

Molecular Function: beta-2-microglobulin binding; exogenous lipid antigen binding; endogenous lipid antigen binding

Biological Process: antigen processing and presentation, exogenous lipid antigen via MHC class Ib; immune response