CD1E recombinant protein

CD1E Recombinant Protein

Cat. Num. AAA3003528

• Gene Names: CD1E; R2; CD1A
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD1E; CD1E Recombinant Protein; CD1E recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: EEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIHWGGY

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 831
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD1E recombinant protein

Background: The human CD1 family consists of five chromosome 1-localized genes which encode proteins that are involved in mediating the presentation of lipid antigens of microbial or self origin on the surface of immune cells. CD1E, also known as R2 or CD1A, is a 322 amino acid single-pass type I membrane protein that localizes to the lumen of the endoplasmic reticulum, as well as to the Golgi apparatus and contains one Ig-like domain. Expressed in a variety of tissues and on cortical thymocytes, dendritic cells and Langerhans cells, CD1E exists as a heterodimer with beta-2-microglobulin and is necessary for the presentation of glycolipid antigens on the cell surface. CD1E is subject to posttranslational mono-ubiquitination and may also be proteolytically cleaved in endosomes to yield a soluble protein. CD1E is present on the surface of some T cell leukemias, suggesting a possible role in tumorigenesis.

NCBI and Uniprot Product Information

• NCBI GI #: 110618230
• NCBI GeneID: 913
• NCBI Accession #: NP_001036048.1
• NCBI GenBank Nucleotide #: NM_001042583.2
• UniProt Accession #: P15812; Q5TDJ9; Q5TDK3; Q5TDK4; Q5TDK5; Q5TDK6; Q5TDK8; Q5TDL1; Q712E4; Q712E5; Q712E6; B4DZV3
• Molecular Weight: 43,626 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD1e, membrane-associated isoform b
• NCBI Official Synonym Full Names: CD1e molecule
• NCBI Official Symbol: CD1E
• NCBI Official Synonym Symbols: R2; CD1A
• NCBI Protein Information: T-cell surface glycoprotein CD1e, membrane-associated; R2G1; hCD1e; thymocyte antigen CD1E; CD1E antigen, e polypeptide; leukocyte differentiation antigen; differentiation antigen CD1-alpha-3
• UniProt Protein Name: T-cell surface glycoprotein CD1e, membrane-associated
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD1E
• UniProt Synonym Gene Names: hCD1e; sCD1e
• UniProt Entry Name: CD1E_HUMAN

NCBI Description

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined. [provided by RefSeq, Jun 2010]

Uniprot Description

CD1E: T-cell surface glycoprotein CD1e, soluble is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. 12 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: Golgi membrane; lysosomal lumen; integral to plasma membrane; late endosome; early endosome; plasma membrane

Molecular Function: beta-2-microglobulin binding; exogenous lipid antigen binding; endogenous lipid antigen binding

Biological Process: antigen processing and presentation, exogenous lipid antigen via MHC class Ib; immune response