Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCL5 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)

Rabbit CCL5 Polyclonal Antibody | anti-CCL5 antibody

CCL5 antibody - middle region

Gene Names
Ccl5; SISd; Scya5; RANTES; TCP228; MuRantes
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CCL5; Polyclonal Antibody; CCL5 antibody - middle region; anti-CCL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
Sequence Length
91
Applicable Applications for anti-CCL5 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 91%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Pig: 91%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCL5 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)

Western Blot (WB) (WB Suggested Anti-CCL5 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-CCL5 antibody
This is a rabbit polyclonal antibody against CCL5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Recently, it has been shown that genetic polymorphisms can result in diminished expression of CCL5, which results in increased susceptibility to and progression of infectious diseases. CCL5, together with Th cytokine mRNA expression, is temporally up-regulated during pneumococcal carriage. CCL5 is an essential factor for the induction and maintenance of protective pneumococcal immunity

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
C-C motif chemokine 5
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 5
NCBI Official Symbol
Ccl5
NCBI Official Synonym Symbols
SISd; Scya5; RANTES; TCP228; MuRantes
NCBI Protein Information
C-C motif chemokine 5
UniProt Protein Name
C-C motif chemokine 5
Protein Family
UniProt Gene Name
Ccl5
UniProt Synonym Gene Names
Scya5
UniProt Entry Name
CCL5_MOUSE

Uniprot Description

CCL5: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. By mitogens. T-cell and macrophage specific. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Cell adhesion; Secreted, signal peptide; Chemokine

Cellular Component: extracellular space; cell; cytoplasm; extracellular region; intracellular

Molecular Function: heparin binding; protein homodimerization activity; protein self-association; cytokine activity; receptor signaling protein tyrosine kinase activator activity; phosphoinositide phospholipase C activity; protein kinase activity; CCR1 chemokine receptor binding; chemokine receptor binding; chemokine activity; chemokine receptor antagonist activity; CCR5 chemokine receptor binding; chemoattractant activity; phospholipase activator activity

Biological Process: positive regulation of cell adhesion; exocytosis; positive regulation of osteoclast differentiation; response to toxin; positive regulation of smooth muscle cell proliferation; positive regulation of smooth muscle cell migration; chemotaxis; protein amino acid phosphorylation; positive regulation of cell-cell adhesion mediated by integrin; pseudopodium formation; positive regulation of homotypic cell-cell adhesion; leukocyte adhesion; positive chemotaxis; cell-cell signaling; calcium ion transport; lipopolysaccharide-mediated signaling pathway; protein kinase B signaling cascade; positive regulation of T cell proliferation; inflammatory response; lymphocyte chemotaxis; protein tetramerization; phospholipase D activation; neutrophil activation; negative regulation of G-protein coupled receptor protein signaling pathway; MAPKKK cascade; positive regulation of cellular biosynthetic process; positive regulation of phosphoinositide 3-kinase cascade; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; cellular protein complex assembly; positive regulation of tyrosine phosphorylation of STAT protein; negative regulation of viral genome replication; response to cytokine stimulus; positive regulation of fever; eosinophil chemotaxis; immune response; positive regulation of neuron differentiation; positive regulation of calcium ion transport; positive regulation of defense response to virus by host; regulation of insulin secretion; positive regulation of phosphorylation; positive regulation of epithelial cell proliferation; positive regulation of cell migration; regulation of T cell activation

Research Articles on CCL5

Similar Products

Product Notes

The CCL5 ccl5 (Catalog #AAA3203489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCL5 ccl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGSDTTPCCF AYLSLELPRA HVKEYFYTSS KCSNLAVVFV TRRNRQVCAN. It is sometimes possible for the material contained within the vial of "CCL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.