Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Ccl20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Heart)

Rabbit Ccl20 Polyclonal Antibody | anti-CCL20 antibody

Ccl20 antibody - C-terminal region

Gene Names
Ccl20; ST38; Scya20
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ccl20; Polyclonal Antibody; Ccl20 antibody - C-terminal region; anti-CCL20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI
Sequence Length
96
Applicable Applications for anti-CCL20 antibody
Western Blot (WB)
Homology
Dog: 85%; Guinea Pig: 88%; Horse: 88%; Human: 100%; Mouse: 88%; Rabbit: 88%; Rat: 94%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Ccl20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Heart)

Western Blot (WB) (WB Suggested Anti-Ccl20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Heart)
Related Product Information for anti-CCL20 antibody
This is a rabbit polyclonal antibody against Ccl20. It was validated on Western Blot

Target Description: Ccl20 is a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Ccl20 may play a role in modulating inflammatory cell recruitment to the CNS and therefore contribute to tissue injury in ischemic stroke and autoimmune diseases.
Product Categories/Family for anti-CCL20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
C-C motif chemokine 20
NCBI Official Synonym Full Names
C-C motif chemokine ligand 20
NCBI Official Symbol
Ccl20
NCBI Official Synonym Symbols
ST38; Scya20
NCBI Protein Information
C-C motif chemokine 20
UniProt Protein Name
C-C motif chemokine 20
Protein Family
UniProt Gene Name
Ccl20
UniProt Synonym Gene Names
Scya20; St38; MIP-3-alpha
UniProt Entry Name
CCL20_RAT

NCBI Description

chemokine upregulated in ischemic brain tissue [RGD, Feb 2006]

Uniprot Description

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells.

Research Articles on CCL20

Similar Products

Product Notes

The CCL20 ccl20 (Catalog #AAA3200289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ccl20 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ccl20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCL20 ccl20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CCLTYTKNVY HHARNFVGFT TQMADEACDI NAIIFHLKSK RSVCADPKQI. It is sometimes possible for the material contained within the vial of "Ccl20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.