Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CCKAR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Mouse CCKAR Polyclonal Antibody | anti-CCKAR antibody

CCKAR Rabbit pAb

Gene Names
CCKAR; CCK-A; CCKRA; CCK1-R
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
CCKAR; Polyclonal Antibody; CCKAR Rabbit pAb; CCK-A; CCK1-R; CCK1R; CCKRA; anti-CCKAR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLL
Applicable Applications for anti-CCKAR antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CCKAR (NP_000721.1).
Positive Samples
Mouse stomach, Mouse lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using CCKAR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CCKAR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CCKAR antibody
Background: This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
886
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,841 Da
NCBI Official Full Name
cholecystokinin receptor type A
NCBI Official Synonym Full Names
cholecystokinin A receptor
NCBI Official Symbol
CCKAR
NCBI Official Synonym Symbols
CCK-A; CCKRA; CCK1-R
NCBI Protein Information
cholecystokinin receptor type A; CCK-AR; CCK-A receptor; cholecystokinin-1 receptor; cholecystokinin type-A receptor
UniProt Protein Name
Cholecystokinin receptor type A
Protein Family
UniProt Gene Name
CCKAR
UniProt Synonym Gene Names
CCKRA; CCK-A receptor; CCK-AR; CCK1-R
UniProt Entry Name
CCKAR_HUMAN

NCBI Description

This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine. [provided by RefSeq, Jul 2008]

Uniprot Description

CCKAR: Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 4p15.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: cholecystokinin receptor activity; peptide binding

Biological Process: elevation of cytosolic calcium ion concentration; axonogenesis; digestion; forebrain development; regulation of hormone secretion; neuron migration; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); feeding behavior; response to nutrient; cellular response to hormone stimulus

Research Articles on CCKAR

Similar Products

Product Notes

The CCKAR cckar (Catalog #AAA9142464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCKAR Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CCKAR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CCKAR cckar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IPNLLKDFIF GSAVCKTTTY FMGTSVSVST FNLVAISLER YGAICKPLQS RVWQTKSHAL KVIAATWCLS FTIMTPYPIY SNLVPFTKNN NQTANMCRFL L. It is sometimes possible for the material contained within the vial of "CCKAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.