Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-Ccer1 Polyclonal Antibody)

Rabbit anti-Human Ccer1 Polyclonal Antibody | anti-Ccer1 antibody

Ccer1 Polyclonal Antibody

Gene Names
Ccer1; AV259683; 4921510H08Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
Ccer1; Polyclonal Antibody; Ccer1 Polyclonal Antibody; CCER1; C12orf12; 4921510H08Rik; AV259683; coiled-coil glutamate rich protein 1; anti-Ccer1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.49 mg/ml (varies by lot)
Sequence Length
406
Applicable Applications for anti-Ccer1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of mouse Ccer1 (NP_080000.1).
Immunogen Sequence
MTQTVNEREDPLNLGGGGWASSIPLRTWSSYHRRQRGAPVSKRRYRDGPKIEYEASRKQPKQQRSPGSWFQPSRGPYWALYSNWERCGGPWRPPLIAFQSPLCPAQMIRAYGLHPLCVCCCSCWSGPWNPGWERPPGRKKRWGRRGRGLRRHPRRSFPRNPPIDLSKMLRPVNLSGWRAPGMRAPRNTTQFIMNQVYEDM
Positive Samples
DU145
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-Ccer1 Polyclonal Antibody)

Western Blot (WB) (Western blot-Ccer1 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 46kDa
Observed: 48kDa
NCBI Official Full Name
coiled-coil domain-containing glutamate-rich protein 1
NCBI Official Synonym Full Names
coiled-coil glutamate-rich protein 1
NCBI Official Symbol
Ccer1
NCBI Official Synonym Symbols
AV259683; 4921510H08Rik
NCBI Protein Information
coiled-coil domain-containing glutamate-rich protein 1
UniProt Protein Name
Coiled-coil domain-containing glutamate-rich protein 1
UniProt Gene Name
CCER1
UniProt Synonym Gene Names
C12orf12
UniProt Entry Name
CCER1_HUMAN

Similar Products

Product Notes

The Ccer1 ccer1 (Catalog #AAA9140943) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ccer1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ccer1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the Ccer1 ccer1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ccer1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.