Western Blot (WB)
(Western blot-ZFP64 Polyclonal Antibody)
Rabbit anti-Human, Mouse ZFP64 Polyclonal Antibody | anti-ZFP64 antibody
ZFP64 Polyclonal Antibody
Gene Names
ZFP64; ZNF338
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ZFP64; Polyclonal Antibody; ZFP64 Polyclonal Antibody; ZNF338; zinc finger protein 64; anti-ZFP64 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
0.94 mg/ml (varies by lot)
Sequence Length
681
Applicable Applications for anti-ZFP64 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZFP64 (NP_060667.2).
Immunogen Sequence
MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSAAAPSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHT
Positive Samples
293T, NIH/3T3, Raji
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-ZFP64 Polyclonal Antibody)
Western Blot (WB)
(Western blot-ZFP64 Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 46kDa; 48kDa; 68kDa; 72kDa; 74kDa
Observed: 75kDa
Observed: 75kDa
NCBI Official Full Name
zinc finger protein 64 isoform a
NCBI Official Synonym Full Names
ZFP64 zinc finger protein
NCBI Official Symbol
ZFP64
NCBI Official Synonym Symbols
ZNF338
NCBI Protein Information
zinc finger protein 64
UniProt Protein Name
Zinc finger protein 64 homolog, isoforms 1 and 2
Protein Family
UniProt Gene Name
ZFP64
UniProt Synonym Gene Names
ZNF338; Zfp-64
UniProt Entry Name
ZF64A_HUMAN
Research Articles on ZFP64
1. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
Similar Products
Product Notes
The ZFP64 zfp64 (Catalog #AAA9140567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP64 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP64 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ZFP64 zfp64 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZFP64, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
