EGF active protein

Recombinant Human EGF Protein

Cat. Num. AAA9141715

• Gene Names: EGF; URG; HOMG4
• Purity: >90% by SDS-PAGE.
• Synonyms: EGF; Recombinant Human EGF Protein; Epidermal Growth Factor; HOMG4; URG; EGF active protein

• Host: HEK293 Cells
• Purity/Purification: >90% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Sequence Length: 1207

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human EGFR at 5 ug/mL (100 uL/well) can bind Human EGF with a linear range of 7-25ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: Fc, 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human EGF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40 kDa.)

Related Product Information for EGF active protein

Description: Recombinant Human EGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn 971-Arg 1023) of human EGF (Accession #NP_001954.2) fused with an Fc, 6xHis tag at the C-terminus.

Background: Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin binding EGF like growth factor (HB_x005f

Product Categories/Family for EGF active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 251757262
• NCBI GeneID: 1950
• UniProt Accession #: P01133
• NCBI Official Full Name: Pro-epidermal growth factor
• NCBI Official Synonym Full Names: epidermal growth factor
• NCBI Official Symbol: EGF
• NCBI Official Synonym Symbols: URG; HOMG4
• NCBI Protein Information: pro-epidermal growth factor
• UniProt Protein Name: Pro-epidermal growth factor
• Protein Family: EGF-like domain containing protein
• UniProt Gene Name: EGF
• UniProt Synonym Gene Names: EGF
• UniProt Entry Name: EGF_HUMAN

NCBI Description

This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]