Western Blot (WB)
(WB Suggested Anti-CCDC117 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysate)
Rabbit anti-Human CCDC117 Polyclonal Antibody | anti-CCDC117 antibody
CCDC117 antibody - middle region
Gene Names
CCDC117; dJ366L4.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCDC117; Polyclonal Antibody; CCDC117 antibody - middle region; anti-CCDC117 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNT
Sequence Length
279
Applicable Applications for anti-CCDC117 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCDC117
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CCDC117 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysate)
Western Blot (WB)
(WB Suggested Anti-CCDC117 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysate)
Related Product Information for anti-CCDC117 antibody
This is a rabbit polyclonal antibody against CCDC117. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-CCDC117 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
coiled-coil domain-containing protein 117 isoform a
NCBI Official Synonym Full Names
coiled-coil domain containing 117
NCBI Official Symbol
CCDC117
NCBI Official Synonym Symbols
dJ366L4.1
NCBI Protein Information
coiled-coil domain-containing protein 117
UniProt Protein Name
Coiled-coil domain-containing protein 117
Protein Family
UniProt Gene Name
CCDC117
UniProt Entry Name
CC117_HUMAN
Similar Products
CCDC146 Antibody
Host: Rabbit
Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rat
Apps: Western Blot
NSG1 Antibody
Host: Rabbit
Reactivity: Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Apps: Western Blot
Product Notes
The CCDC117 ccdc117 (Catalog #AAA3211219) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC117 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC117 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCDC117 ccdc117 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTMKTGLKRE FDEVFTKKMI ESMSRPSMEL VLWKPLPELL SDKPKPSSNT. It is sometimes possible for the material contained within the vial of "CCDC117, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
