Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CBLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: COLO205 cell lysate)

Rabbit CBLL1 Polyclonal Antibody | anti-CBLL1 antibody

CBLL1 antibody - N-terminal region

Gene Names
CBLL1; HAKAI; RNF188
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CBLL1; Polyclonal Antibody; CBLL1 antibody - N-terminal region; anti-CBLL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR
Sequence Length
491
Applicable Applications for anti-CBLL1 antibody
Western Blot (WB)
Homology
Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CBLL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CBLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-CBLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: COLO205 cell lysate)
Related Product Information for anti-CBLL1 antibody
This is a rabbit polyclonal antibody against CBLL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a conse
Product Categories/Family for anti-CBLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase Hakai isoform 1
NCBI Official Synonym Full Names
Cbl proto-oncogene like 1
NCBI Official Symbol
CBLL1
NCBI Official Synonym Symbols
HAKAI; RNF188
NCBI Protein Information
E3 ubiquitin-protein ligase Hakai
UniProt Protein Name
E3 ubiquitin-protein ligase Hakai
UniProt Gene Name
CBLL1
UniProt Synonym Gene Names
HAKAI; RNF188
UniProt Entry Name
HAKAI_HUMAN

NCBI Description

This gene encodes an E3 ubiquitin-ligase for the E-cadherin complex and mediates its ubiquitination, endocytosis, and degradation in the lysosomes. The encoded protein contains a RING-finger domain and is also thought to have a role in control of cell proliferation. A related pseudogene has been identified on chromosome X. Alternative splicing results in a non-coding transcript variant. [provided by RefSeq, Aug 2011]

Uniprot Description

CBLL1: Promotes ubiquitination of tyrosine-phosphorylated CDH1, thus targeting CDH1 for endocytosis and degradation.

Protein type: EC 6.3.2.19; Ligase; Motility/polarity/chemotaxis; EC 6.3.2.-; Cell adhesion; C2H2-type zinc finger protein; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 7q22.3

Cellular Component: ubiquitin ligase complex

Molecular Function: identical protein binding; protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: cell-cell adhesion; protein ubiquitination; positive regulation of endocytosis; negative regulation of cell adhesion; positive regulation of cell migration

Research Articles on CBLL1

Similar Products

Product Notes

The CBLL1 cbll1 (Catalog #AAA3204745) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBLL1 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CBLL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CBLL1 cbll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDHTDNELQG TNSSGSLGGL DVRRRIPIKL ISKQANKAKP APRTQRTINR. It is sometimes possible for the material contained within the vial of "CBLL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.