Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CBLL1 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse CBLL1 Monoclonal Antibody | anti-CBLL1 antibody

CBLL1 (Cas-Br-M (murine) Ecotropic Retroviral Transforming Sequence-like 1, FLJ23109, HAKAI, MGC163401, MGC163403, RNF188) (AP)

Gene Names
CBLL1; HAKAI; RNF188
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CBLL1; Monoclonal Antibody; CBLL1 (Cas-Br-M (murine) Ecotropic Retroviral Transforming Sequence-like 1; FLJ23109; HAKAI; MGC163401; MGC163403; RNF188) (AP); Cas-Br-M (murine) Ecotropic Retroviral Transforming Sequence-like 1; RNF188; anti-CBLL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B12
Specificity
Recognizes CBLL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CBLL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CBLL1 (NP_079090, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CBLL1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CBLL1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CBLL1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CBLL1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CBLL1 antibody
Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex. [supplied by OMIM]
Product Categories/Family for anti-CBLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,791 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase Hakai isoform 1
NCBI Official Synonym Full Names
Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase
NCBI Official Symbol
CBLL1
NCBI Official Synonym Symbols
HAKAI; RNF188
NCBI Protein Information
E3 ubiquitin-protein ligase Hakai; Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1; Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1; E-cadherin binding protein E7; RING finger protein 188; c-Cbl-like protein 1; casitas B-lineage
UniProt Protein Name
cDNA FLJ57701, highly similar to Homo sapiens Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1 (CBLL1), mRNA
UniProt Entry Name
B4DDV7_HUMAN

Similar Products

Product Notes

The CBLL1 (Catalog #AAA6165216) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CBLL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBLL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBLL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.