Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human SHSY5YSample: SH-SY5Y cells  2.0x105 cells Primary dilution: 1:2500Secondary Antibody: HRP-conjugated goat anti-rabbit IgG Secondary dilution: 1:5000Image Submitted by: Atsuhiro TanabePharma Sci Kitasato University )

Rabbit CASP6 Polyclonal Antibody | anti-CASP6 antibody

CASP6 antibody - middle region

Gene Names
CASP6; MCH2
Reactivity
Human, Mouse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CASP6; Polyclonal Antibody; CASP6 antibody - middle region; anti-CASP6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY
Sequence Length
293
Applicable Applications for anti-CASP6 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 82%; Pig: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CASP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human SHSY5YSample: SH-SY5Y cells  2.0x105 cells Primary dilution: 1:2500Secondary Antibody: HRP-conjugated goat anti-rabbit IgG Secondary dilution: 1:5000Image Submitted by: Atsuhiro TanabePharma Sci Kitasato University )

Western Blot (WB) (Sample Type: Human SHSY5YSample: SH-SY5Y cells  2.0x105 cells Primary dilution: 1:2500Secondary Antibody: HRP-conjugated goat anti-rabbit IgG Secondary dilution: 1:5000Image Submitted by: Atsuhiro TanabePharma Sci Kitasato University )

Western Blot (WB)

(WB Suggested Anti-CASP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CASP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)
Related Product Information for anti-CASP6 antibody
This is a rabbit polyclonal antibody against CASP6. It was validated on Western Blot

Target Description: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in two transcript variants that encode different isoforms.
Product Categories/Family for anti-CASP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
839
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
caspase-6 isoform alpha
NCBI Official Synonym Full Names
caspase 6
NCBI Official Symbol
CASP6
NCBI Official Synonym Symbols
MCH2
NCBI Protein Information
caspase-6
UniProt Protein Name
Caspase-6
Protein Family
UniProt Gene Name
CASP6
UniProt Synonym Gene Names
MCH2; CASP-6
UniProt Entry Name
CASP6_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Oct 2015]

Uniprot Description

CASP6: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves poly(ADP-ribose) polymerase in vitro, as well as lamins. Overexpression promotes programmed cell death. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce. Activation is suppressed by phosphorylation at Ser-257. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.59; Protease; Apoptosis

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: epithelial cell differentiation; apoptosis; proteolysis; cell structure disassembly during apoptosis

Research Articles on CASP6

Similar Products

Product Notes

The CASP6 casp6 (Catalog #AAA3214147) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP6 antibody - middle region reacts with Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CASP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP6 casp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QACRGNQHDV PVIPLDVVDN QTEKLDTNIT EVDAASVYTL PAGADFLMCY. It is sometimes possible for the material contained within the vial of "CASP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.