Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human SHSY5YSample: SH-SY5Y cells,  2.0x105 cells Primary dilution: 1:2500Secondary Antibody: HRP-conjugated goat anti-rabbit IgGSecondary dilution: 1:5000Image Submitted by: Atsuhiro TanabePharma Sci Kitasato University )

Rabbit CASP7 Polyclonal Antibody | anti-CASP7 antibody

CASP7 antibody - N-terminal region

Gene Names
CASP7; MCH3; CMH-1; LICE2; CASP-7; ICE-LAP3
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CASP7; Polyclonal Antibody; CASP7 antibody - N-terminal region; anti-CASP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLL
Sequence Length
336
Applicable Applications for anti-CASP7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CASP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human SHSY5YSample: SH-SY5Y cells,  2.0x105 cells Primary dilution: 1:2500Secondary Antibody: HRP-conjugated goat anti-rabbit IgGSecondary dilution: 1:5000Image Submitted by: Atsuhiro TanabePharma Sci Kitasato University )

Western Blot (WB) (Sample Type: Human SHSY5YSample: SH-SY5Y cells,  2.0x105 cells Primary dilution: 1:2500Secondary Antibody: HRP-conjugated goat anti-rabbit IgGSecondary dilution: 1:5000Image Submitted by: Atsuhiro TanabePharma Sci Kitasato University )

Western Blot (WB)

(WB Suggested Anti-CASP7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateCASP7 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-CASP7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateCASP7 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-CASP7 antibody
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms.
Product Categories/Family for anti-CASP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
840
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
caspase-7 isoform delta
NCBI Official Synonym Full Names
caspase 7
NCBI Official Symbol
CASP7
NCBI Official Synonym Symbols
MCH3; CMH-1; LICE2; CASP-7; ICE-LAP3
NCBI Protein Information
caspase-7
UniProt Protein Name
Caspase-7
Protein Family
UniProt Gene Name
CASP7
UniProt Synonym Gene Names
MCH3; CASP-7; ICE-LAP3
UniProt Entry Name
CASP7_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]

Uniprot Description

CASP7: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly- 217' bond. Overexpression promotes programmed cell death. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce. Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain. Inhibited by isatin sulfonamides. Belongs to the peptidase C14A family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.60; Endoplasmic reticulum; Protease; Mitochondrial; Apoptosis

Chromosomal Location of Human Ortholog: 10q25

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: apoptosis; caspase activation via cytochrome c; proteolysis; cell structure disassembly during apoptosis

Research Articles on CASP7

Similar Products

Product Notes

The CASP7 casp7 (Catalog #AAA3214148) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP7 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CASP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP7 casp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNKNFDKVTG MGVRNGTDKD AEALFKCFRS LGFDVIVYND CSCAKMQDLL. It is sometimes possible for the material contained within the vial of "CASP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.