Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CARS2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CARS2 Polyclonal Antibody | anti-CARS2 antibody

CARS2 Antibody - N-terminal region

Gene Names
CARS2; cysRS; COXPD27
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CARS2; Polyclonal Antibody; CARS2 Antibody - N-terminal region; anti-CARS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW
Sequence Length
564
Applicable Applications for anti-CARS2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CARS2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CARS2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CARS2 antibody
This is a rabbit polyclonal antibody against CARS2. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-CARS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
probable cysteine--tRNA ligase, mitochondrial isoform 1
NCBI Official Synonym Full Names
cysteinyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
CARS2
NCBI Official Synonym Symbols
cysRS; COXPD27
NCBI Protein Information
probable cysteine--tRNA ligase, mitochondrial
UniProt Protein Name
Probable cysteine--tRNA ligase, mitochondrial
UniProt Gene Name
CARS2
UniProt Synonym Gene Names
CysRS

NCBI Description

This gene encodes a putative member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of cysteine to tRNA molecules. A splice-site mutation in this gene has been associated with a novel progressive myoclonic epilepsy disease with similar symptoms to MERRF syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017]

Uniprot Description

CARS2: Belongs to the class-I aminoacyl-tRNA synthetase family.

Protein type: Aminoacyl-tRNA synthetase; EC 6.1.1.16; Ligase; Mitochondrial; Translation; Translation regulation

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: cytoplasm; mitochondrial matrix

Molecular Function: ATP binding; cysteine-tRNA ligase activity; metal ion binding

Biological Process: cysteinyl-tRNA aminoacylation

Disease: Combined Oxidative Phosphorylation Deficiency 27

Research Articles on CARS2

Similar Products

Product Notes

The CARS2 cars2 (Catalog #AAA3217743) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARS2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CARS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CARS2 cars2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNAYSTAKGN VYFDLKSRGD KYGKLVGVVP GPVGEPADSD KRHASDFALW. It is sometimes possible for the material contained within the vial of "CARS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.