Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Carboxylesterase 7 antibody (MBS5300142) used at 1 ug/ml to detect target protein.)

Rabbit Carboxylesterase 7 Polyclonal Antibody | anti-CES5A antibody

Carboxylesterase 7 antibody

Gene Names
CES5A; CES5; CES7; CAUXIN; CES4C1; HEL126
Applications
Western Blot
Purity
Affinity purified
Synonyms
Carboxylesterase 7; Polyclonal Antibody; Carboxylesterase 7 antibody; Polyclonal Carboxylesterase 7; Anti-Carboxylesterase 7; FLJ31547; CES5; CES4C1; Carboxylesterase -7; CAUXIN; CES7; anti-CES5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Carboxylesterase 7 antibody was raised against the N terminal of CES7
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CES7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
525
Applicable Applications for anti-CES5A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
Cross-Reactivity
Human
Immunogen
Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Carboxylesterase 7 antibody (MBS5300142) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Carboxylesterase 7 antibody (MBS5300142) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CES5A antibody
Rabbit polyclonal Carboxylesterase 7 antibody raised against the N terminal of CES7
Product Categories/Family for anti-CES5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
58 kDa (MW of target protein)
NCBI Official Full Name
Carboxylesterase 7
NCBI Official Synonym Full Names
carboxylesterase 5A
NCBI Official Symbol
CES5A
NCBI Official Synonym Symbols
CES5; CES7; CAUXIN; CES4C1; HEL126
NCBI Protein Information
carboxylesterase 5A
UniProt Protein Name
Carboxylesterase 5A
Protein Family
UniProt Gene Name
CES5A
UniProt Synonym Gene Names
CES7; Cauxin
UniProt Entry Name
EST5A_HUMAN

NCBI Description

This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They also participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene, also called CES5, is predominantly expressed in peripheral tissues, including brain, kidney, lung and testis. It encodes a secreted enzyme. Because of high levels in the urine of male domestic cats, this enzyme is also called cauxin (carboxylesterase-like urinary excreted protein). The enzyme functions in regulating the production of a pheromone precursor and may contribute to lipid and cholesterol transfer processes within male reproductive fluids. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

CES7: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Belongs to the type-B carboxylesterase/lipase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Secreted; Xenobiotic Metabolism - drug metabolism - other enzymes; EC 3.1.1.1; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: extracellular space

Biological Process: metabolic process

Research Articles on CES5A

Similar Products

Product Notes

The CES5A ces5a (Catalog #AAA5300142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Carboxylesterase 7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CES5A ces5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Carboxylesterase 7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.