Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CREG1 Monoclonal Antibody | anti-CREG1 antibody

CREG1 (Cellular Repressor of E1A-stimulated Genes 1, CREG 1, CREG, Protein CREG1, UNQ727/PRO1409) (HRP)

Gene Names
CREG1; CREG
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREG1; Monoclonal Antibody; CREG1 (Cellular Repressor of E1A-stimulated Genes 1; CREG 1; CREG; Protein CREG1; UNQ727/PRO1409) (HRP); anti-CREG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B7
Specificity
Recognizes human CREG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CREG1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa121-221 from CREG1 (NP_003842) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVTPEEYYNVTVQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(CREG1 monoclonal antibody Western Blot analysis of CREG1 expression in HL-60.)

Western Blot (WB) (CREG1 monoclonal antibody Western Blot analysis of CREG1 expression in HL-60.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CREG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CREG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CREG1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CREG1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-CREG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein CREG1
NCBI Official Synonym Full Names
cellular repressor of E1A stimulated genes 1
NCBI Official Symbol
CREG1
NCBI Official Synonym Symbols
CREG
NCBI Protein Information
protein CREG1
UniProt Protein Name
Protein CREG1
Protein Family
UniProt Gene Name
CREG1
UniProt Synonym Gene Names
CREG
UniProt Entry Name
CREG1_HUMAN

NCBI Description

The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

CREG1: May contribute to the transcriptional control of cell growth and differentiation. Antagonizes transcriptional activation and cellular transformation by the adenovirus E1A protein. The transcriptional control activity of cell growth requires interaction with IGF2R. Belongs to the CREG family.

Protein type: Secreted, signal peptide; Secreted; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: transcription factor complex

Molecular Function: FMN binding; oxidoreductase activity; transcription factor binding; transcription corepressor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; cell proliferation; regulation of growth; multicellular organismal development

Research Articles on CREG1

Similar Products

Product Notes

The CREG1 creg1 (Catalog #AAA6151958) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREG1 (Cellular Repressor of E1A-stimulated Genes 1, CREG 1, CREG, Protein CREG1, UNQ727/PRO1409) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREG1 creg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.