Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Carbonyl Reductase 1 antibody (MBS5302722) used at 1 ug/ml to detect target protein.)

Rabbit Carbonyl Reductase 1 Polyclonal Antibody | anti-CBR1 antibody

Carbonyl Reductase 1 antibody

Gene Names
CBR1; CBR; hCBR1; SDR21C1
Applications
Western Blot
Purity
Affinity purified
Synonyms
Carbonyl Reductase 1; Polyclonal Antibody; Carbonyl Reductase 1 antibody; Polyclonal Carbonyl Reductase 1; Anti-Carbonyl Reductase 1; Carbonyl Reductase -1; hCBR1; CBR1; CBR; anti-CBR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Carbonyl Reductase 1 antibody was raised against the middle region of CBR1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CBR1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
277
Applicable Applications for anti-CBR1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
Cross-Reactivity
Human
Immunogen
Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Carbonyl Reductase 1 antibody (MBS5302722) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Carbonyl Reductase 1 antibody (MBS5302722) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CBR1 antibody
Rabbit polyclonal Carbonyl Reductase 1 antibody raised against the middle region of CBR1
Product Categories/Family for anti-CBR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
873
Molecular Weight
30 kDa (MW of target protein)
NCBI Official Full Name
carbonyl reductase 1
NCBI Official Synonym Full Names
carbonyl reductase 1
NCBI Official Symbol
CBR1
NCBI Official Synonym Symbols
CBR; hCBR1; SDR21C1
NCBI Protein Information
carbonyl reductase [NADPH] 1
UniProt Protein Name
Carbonyl reductase [NADPH] 1
Protein Family
UniProt Gene Name
CBR1
UniProt Synonym Gene Names
CBR; CRN; SDR21C1
UniProt Entry Name
CBR1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

CBR1: NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: EC 1.1.1.197; EC 1.1.1.189; Lipid Metabolism - arachidonic acid; EC 1.1.1.184; Oxidoreductase

Chromosomal Location of Human Ortholog: 21q22.13

Cellular Component: cytosol; vesicle

Molecular Function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; prostaglandin-E2 9-reductase activity; 15-hydroxyprostaglandin dehydrogenase (NADP+) activity; carbonyl reductase (NADPH) activity

Biological Process: epithelial cell differentiation; vitamin K metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; drug metabolic process

Research Articles on CBR1

Similar Products

Product Notes

The CBR1 cbr1 (Catalog #AAA5302722) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Carbonyl Reductase 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CBR1 cbr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Carbonyl Reductase 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.