Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Carbonyl reductase [NADPH] 1 Recombinant Protein | CBR1 recombinant protein

Recombinant Human Carbonyl reductase [NADPH] 1

Gene Names
CBR1; CBR; hCBR1; SDR21C1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonyl reductase [NADPH] 1; Recombinant Human Carbonyl reductase [NADPH] 1; 15-hydroxyprostaglandin dehydrogenase [NADP(+)] (EC:1.1.1.197); NADPH-dependent carbonyl reductase 1; Prostaglandin 9-ketoreductase; Prostaglandin-E(2) 9-reductase (EC:1.1.1.189); Short chain dehydrogenase/reductase family 21C member 1; CBR1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-277aa; Full Length
Sequence
SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Sequence Length
173
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CBR1 recombinant protein
NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
Product Categories/Family for CBR1 recombinant protein
References
Human carbonyl reductase. Nucleotide sequence analysis of a cDNA and amino acid sequence of the encoded protein.Wermuth B., Bohren K.M., Heinemann G., von Wartburg J.-P., Gabbay K.H.J. Biol. Chem. 263:16185-16188(1988)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
873
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57.6kD
NCBI Official Full Name
carbonyl reductase
NCBI Official Synonym Full Names
carbonyl reductase 1
NCBI Official Symbol
CBR1
NCBI Official Synonym Symbols
CBR; hCBR1; SDR21C1
NCBI Protein Information
carbonyl reductase [NADPH] 1
UniProt Protein Name
Carbonyl reductase [NADPH] 1
Protein Family
UniProt Gene Name
CBR1
UniProt Synonym Gene Names
CBR; CRN; SDR21C1
UniProt Entry Name
CBR1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

CBR1: NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Oxidoreductase; EC 1.1.1.197; EC 1.1.1.184; Lipid Metabolism - arachidonic acid; EC 1.1.1.189

Chromosomal Location of Human Ortholog: 21q22.13

Cellular Component: cytosol

Molecular Function: 15-hydroxyprostaglandin dehydrogenase (NADP+) activity; carbonyl reductase (NADPH) activity; oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; prostaglandin-E2 9-reductase activity

Biological Process: arachidonic acid metabolic process; cyclooxygenase pathway; drug metabolic process; epithelial cell differentiation; vitamin K metabolic process

Research Articles on CBR1

Similar Products

Product Notes

The CBR1 cbr1 (Catalog #AAA956537) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-277aa; Full Length. The amino acid sequence is listed below: SSGIHVALVT GGNKGIGLAI VRDLCRLFSG DVVLTARDVT RGQAAVQQLQ AEGLSPRFHQ LDIDDLQSIR ALRDFLRKEY GGLDVLVNNA GIAFKVADPT PFHIQAEVTM KTNFFGTRDV CTELLPLIKP QGRVVNVSSI MSVRALKSCS PELQQKFRSE TITEEELVGL MNKFVEDTKK GVHQKEGWPS SAYGVTKIGV TVLSRIHARK LSEQRKGDKI LLNACCPGWV RTDMAGPKAT KSPEEGAETP VYLALLPPDA EGPHGQFVSE KRVEQW. It is sometimes possible for the material contained within the vial of "Carbonyl reductase [NADPH] 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.