Western Blot (WB)
(Sample Type: Human Huh7, HepG2Sample Type: Huh7 HepG2 (50ug)Primary Antibody Dilution:1:500Image Submitted By: Partha KasturiUniversity of Kansas Medical Center )
Rabbit CAPS Polyclonal Antibody | anti-CAPS antibody
CAPS antibody - N-terminal region
Gene Names
CAPS; CAPS1
Reactivity
Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPS; Polyclonal Antibody; CAPS antibody - N-terminal region; anti-CAPS antibody
Host
Rabbit
Reactivity
Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Sequence Length
189
Applicable Applications for anti-CAPS antibody
Western Blot (WB)
Homology
Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAPS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: Human Huh7, HepG2Sample Type: Huh7 HepG2 (50ug)Primary Antibody Dilution:1:500Image Submitted By: Partha KasturiUniversity of Kansas Medical Center )
Western Blot (WB)
(Sample Type: Human Huh7, HepG2Sample Type: Huh7 HepG2 (50ug)Primary Antibody Dilution:1:500Image Submitted By: Partha KasturiUniversity of Kansas Medical Center )
Western Blot (WB)
(WB Suggested Anti-CAPS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-CAPS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-CAPS antibody
This is a rabbit polyclonal antibody against CAPS. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Target Description: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Product Categories/Family for anti-CAPS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
calcyphosin isoform a
NCBI Official Synonym Full Names
calcyphosine
NCBI Official Symbol
CAPS
NCBI Official Synonym Symbols
CAPS1
NCBI Protein Information
calcyphosin
UniProt Protein Name
Calcyphosin
Protein Family
UniProt Gene Name
CAPS
UniProt Entry Name
CAYP1_HUMAN
NCBI Description
This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008]
Uniprot Description
CAPS: Calcium-binding protein. May play a role in cellular signaling events (Potential).
Protein type: Calcium-binding
Chromosomal Location of Human Ortholog: 19p13.3
Cellular Component: cytoplasm; plasma membrane; nucleus; vesicle
Molecular Function: calcium ion binding
Research Articles on CAPS
Similar Products
Product Notes
The CAPS caps (Catalog #AAA3213887) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPS antibody - N-terminal region reacts with Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAPS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPS caps for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAVDATMEKL RAQCLSRGAS GIQGLARFFR QLDRDGSRSL DADEFRQGLA. It is sometimes possible for the material contained within the vial of "CAPS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
