Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Chicken, TurkeySample Type: 1. DF-1 cells (0.5x106 cells loaded)2. MSB-1 cells  (0.5x106 cells loaded)Primary Dilution: 1:1000 Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution:1:10,000 Image Submitted By: Yongxiu YaoInstitute for Animal Health  )

Rabbit WASF3 Polyclonal Antibody | anti-WASF3 antibody

WASF3 antibody - N-terminal region

Gene Names
WASF3; SCAR3; WAVE3; Brush-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WASF3; Polyclonal Antibody; WASF3 antibody - N-terminal region; anti-WASF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
Sequence Length
502
Applicable Applications for anti-WASF3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WASF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Chicken, TurkeySample Type: 1. DF-1 cells (0.5x106 cells loaded)2. MSB-1 cells  (0.5x106 cells loaded)Primary Dilution: 1:1000 Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution:1:10,000 Image Submitted By: Yongxiu YaoInstitute for Animal Health  )

Western Blot (WB) (Sample Type: Chicken, TurkeySample Type: 1. DF-1 cells (0.5x106 cells loaded)2. MSB-1 cells  (0.5x106 cells loaded)Primary Dilution: 1:1000 Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution:1:10,000 Image Submitted By: Yongxiu YaoInstitute for Animal Health  )

Western Blot (WB)

(WB Suggested Anti-WASF3 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-WASF3 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-WASF3 antibody
This is a rabbit polyclonal antibody against WASF3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-WASF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
wiskott-Aldrich syndrome protein family member 3 isoform 1
NCBI Official Synonym Full Names
WASP family member 3
NCBI Official Symbol
WASF3
NCBI Official Synonym Symbols
SCAR3; WAVE3; Brush-1
NCBI Protein Information
wiskott-Aldrich syndrome protein family member 3
UniProt Protein Name
Wiskott-Aldrich syndrome protein family member 3
UniProt Gene Name
WASF3
UniProt Synonym Gene Names
KIAA0900; SCAR3; WAVE3; WASP family protein member 3
UniProt Entry Name
WASF3_HUMAN

NCBI Description

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. A pseudogene of this gene have been defined on chromosome 6. Alternative splicing results in multiple transcript variants [provided by RefSeq, May 2014]

Uniprot Description

WASF3: Downstream effector molecules involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. Binds actin and the Arp2/3 complex. Expressed in ovary and brain. Belongs to the SCAR/WAVE family.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: cytoskeleton; lamellipodium; cytoplasm

Molecular Function: actin binding

Biological Process: positive regulation of myelination; lamellipodium biogenesis; regulation of cell shape; actin filament polymerization; protein complex assembly; cytoskeleton organization and biogenesis; oligodendrocyte development

Research Articles on WASF3

Similar Products

Product Notes

The WASF3 wasf3 (Catalog #AAA3210672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WASF3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WASF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WASF3 wasf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMKKAFKSST VQDQQVVSKN SIPNPVADIY NQSDKPPPLN ILTPYRDDKK. It is sometimes possible for the material contained within the vial of "WASF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.