Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CAMLG Polyclonal Antibody | anti-CAMLG antibody

CAMLG (Calcium Signal-modulating Cyclophilin Ligand, CAML, CAML) (MaxLight 405)

Gene Names
CAMLG; CAML
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAMLG; Polyclonal Antibody; CAMLG (Calcium Signal-modulating Cyclophilin Ligand; CAML; CAML) (MaxLight 405); anti-CAMLG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CAMLG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CAMLG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CAMLG, aa1-296 (NP_001736.1).
Immunogen Sequence
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CAMLG antibody
Likely involved in the mobilization of calcium as a result of the TCR/CD3 complex interaction. Binds to cyclophilin B.
Product Categories/Family for anti-CAMLG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
819
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,953 Da
NCBI Official Full Name
calcium signal-modulating cyclophilin ligand
NCBI Official Synonym Full Names
calcium modulating ligand
NCBI Official Symbol
CAMLG
NCBI Official Synonym Symbols
CAML
NCBI Protein Information
calcium signal-modulating cyclophilin ligand; calcium-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; cyclophilin B-binding protein
UniProt Protein Name
Calcium signal-modulating cyclophilin ligand
UniProt Gene Name
CAMLG
UniProt Synonym Gene Names
CAML; CAML
UniProt Entry Name
CAMLG_HUMAN

NCBI Description

The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq, Jul 2008]

Uniprot Description

CAMLG: Likely involved in the mobilization of calcium as a result of the TCR/CD3 complex interaction. Binds to cyclophilin B.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 5q23

Cellular Component: membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; cell adhesion molecule binding

Biological Process: receptor recycling; epidermal growth factor receptor signaling pathway; viral reproduction; defense response; signal transduction

Research Articles on CAMLG

Similar Products

Product Notes

The CAMLG camlg (Catalog #AAA6372140) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMLG (Calcium Signal-modulating Cyclophilin Ligand, CAML, CAML) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMLG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAMLG camlg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAMLG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.