Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2.)

Mouse ACP1 Monoclonal Antibody | anti-ACP1 antibody

ACP1 (Acid Phosphatase 1, Soluble, HAAP, MGC111030, MGC3499) (APC)

Gene Names
ACP1; HAAP; LMWPTP; LMW-PTP
Applications
Western Blot
Purity
Purified
Synonyms
ACP1; Monoclonal Antibody; ACP1 (Acid Phosphatase 1; Soluble; HAAP; MGC111030; MGC3499) (APC); Acid Phosphatase 1; MGC3499; anti-ACP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG
Clone Number
2A3
Specificity
Recognizes ACP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
158
Applicable Applications for anti-ACP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ACP1 (AAH07422, 1aa-158aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2.)

Western Blot (WB) (ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2.)

Western Blot (WB)

(ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in NIH/3T3.)

Western Blot (WB) (ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in NIH/3T3.)

Western Blot (WB)

(ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in PC-12.)

Western Blot (WB) (ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in PC-12.)

Western Blot (WB)

(ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in Raw 264.7.)

Western Blot (WB) (ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody (M06), clone 2A3.Lane 1: ACP1 transfected lysate(18 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody (M06), clone 2A3.Lane 1: ACP1 transfected lysate(18 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ACP1 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACP1 is 3 ng/ml as a capture antibody.)
Related Product Information for anti-ACP1 antibody
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-ACP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
52
NCBI Official Full Name
Acid phosphatase 1, soluble
NCBI Official Synonym Full Names
acid phosphatase 1
NCBI Official Symbol
ACP1
NCBI Official Synonym Symbols
HAAP; LMWPTP; LMW-PTP
NCBI Protein Information
low molecular weight phosphotyrosine protein phosphatase
Protein Family

NCBI Description

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]

Research Articles on ACP1

Similar Products

Product Notes

The ACP1 (Catalog #AAA6168361) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.