Western Blot (WB)
(Host: RabbitTarget Name: Camk1dSample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Camk1d Polyclonal Antibody | anti-CAMK1D antibody
Camk1d Antibody - N-terminal region
Gene Names
Camk1d; CKLiK; mCKLiK; CaMKIdelta; A630059D12Rik; E030025C11Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Camk1d; Polyclonal Antibody; Camk1d Antibody - N-terminal region; anti-CAMK1D antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY
Sequence Length
385
Applicable Applications for anti-CAMK1D antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Camk1d
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Camk1dSample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Camk1dSample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CAMK1D antibody
This is a rabbit polyclonal antibody against Camk1d. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-CAMK1D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1D isoform a
NCBI Official Synonym Full Names
calcium/calmodulin-dependent protein kinase ID
NCBI Official Symbol
Camk1d
NCBI Official Synonym Symbols
CKLiK; mCKLiK; CaMKIdelta; A630059D12Rik; E030025C11Rik
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1D
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1D
Protein Family
UniProt Gene Name
Camk1d
UniProt Synonym Gene Names
CaM-KI delta; CaMKI delta; CKLiK; mCKLiK
UniProt Entry Name
KCC1D_MOUSE
Research Articles on CAMK1D
Similar Products
Product Notes
The CAMK1D camk1d (Catalog #AAA3213346) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Camk1d Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Camk1d can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK1D camk1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAEEKATGKL FAVKCIPKKA LKGKESSIEN EIAVLRKIKH ENIVALEDIY. It is sometimes possible for the material contained within the vial of "Camk1d, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
