Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAMK1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CAMK1 Polyclonal Antibody | anti-CAMK1 antibody

CAMK1 Antibody - middle region

Gene Names
CAMK1; CAMKI
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CAMK1; Polyclonal Antibody; CAMK1 Antibody - middle region; anti-CAMK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQA
Sequence Length
357
Applicable Applications for anti-CAMK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAMK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAMK1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CAMK1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CAMK1 antibody
Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase.
Product Categories/Family for anti-CAMK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase I
NCBI Official Symbol
CAMK1
NCBI Official Synonym Symbols
CAMKI
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1D
UniProt Gene Name
CAMK1D
UniProt Synonym Gene Names
CAMKID; CaM kinase ID; CaM-KI delta; CaMKI delta; CaMKID; CKLiK
UniProt Entry Name
KCC1D_HUMAN

NCBI Description

Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008]

Uniprot Description

CAMK1D: a calcium/calmodulin-dependent S/T protein kinase of the CAMK group. Binding of calmodulin is thought to result in a conformational change and can lead to subsequent activation through phosphorylation by CAMKK1 and CAMKK2. Can be activated by CAMKK1 in a calcium-independent manner. Its Ca(2+)/CaM-dependent activity is enhanced 30-fold in vitro by phosphorylation at Thr180 by CaMKK1. Broadly expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes. May regulate calcium-mediated granulocyte function. May play a role in apoptosis of erythroleukemia cells. In vitro, phosphorylates transcription factor CREM isoform Beta and probably CREB1. Expression increases upon treatment of EC cells with DMSO and retinoic acid. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; EC 2.7.11.17; CAMK group; CAMK1 family

Chromosomal Location of Human Ortholog: 10p13

Cellular Component: cytoplasm; nucleus

Molecular Function: calmodulin binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: positive regulation of apoptosis; positive regulation of phagocytosis; activation of CREB transcription factor; regulation of dendrite development; inflammatory response; protein amino acid phosphorylation; negative regulation of apoptosis

Research Articles on CAMK1

Similar Products

Product Notes

The CAMK1 camk1d (Catalog #AAA3222474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK1 camk1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENDAKLFEQI LKAEYEFDSP YWDDISDSAK DFIRHLMEKD PEKRFTCEQA. It is sometimes possible for the material contained within the vial of "CAMK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.