Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CALR3 rabbit polyclonal antibody. Western Blot analysis of CALR3 expression in mouse lung.)

Rabbit anti-Human, Mouse CALR3 Polyclonal Antibody | anti-CALR3 antibody

CALR3 (Calreticulin 3, Calreticulin-3, Calreticulin-2, Calsperin, CRT2)

Gene Names
CALR3; CRT2; CT93; CMH19
Reactivity
Human, Mouse
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
CALR3; Polyclonal Antibody; CALR3 (Calreticulin 3; Calreticulin-3; Calreticulin-2; Calsperin; CRT2); Anti -CALR3 (Calreticulin 3; anti-CALR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CALR3. Species Crossreactivity: mouse.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Applicable Applications for anti-CALR3 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human CALR3, aa1-384 (NP_659483.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CALR3 rabbit polyclonal antibody. Western Blot analysis of CALR3 expression in mouse lung.)

Western Blot (WB) (CALR3 rabbit polyclonal antibody. Western Blot analysis of CALR3 expression in mouse lung.)

Immunoprecipitation (IP)

(Immunoprecipitation of CALR3 transfected lysate using CALR3 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with CALR3 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CALR3 transfected lysate using CALR3 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with CALR3 mouse polyclonal antibody.)
Related Product Information for anti-CALR3 antibody
During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (By similarity). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR.
Product Categories/Family for anti-CALR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,996 Da
NCBI Official Full Name
calreticulin-3
NCBI Official Synonym Full Names
calreticulin 3
NCBI Official Symbol
CALR3
NCBI Official Synonym Symbols
CRT2; CT93; CMH19
NCBI Protein Information
calreticulin-3; calsperin; calreticulin-2; cancer/testis antigen 93
UniProt Protein Name
Calreticulin-3
Protein Family
UniProt Gene Name
CALR3
UniProt Synonym Gene Names
CRT2
UniProt Entry Name
CALR3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011]

Uniprot Description

Function: During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility

By similarity. CALR3 capacity for calcium-binding may be absent or much lower than that of CALR. Ref.1

Subunit structure: Component of an EIF2 complex at least composed of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1 and HSPA5

By similarity.

Subcellular location: Endoplasmic reticulum lumen Ref.1.

Tissue specificity: Testis specific. Ref.6

Domain: Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity

By similarity.The interaction with glycans occurs through a binding site in the globular lectin domain

By similarity.The zinc binding sites are localized to the N-domain

By similarity.

Involvement in disease: Cardiomyopathy, familial hypertrophic 19 (CMH19) [MIM:613875]: A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.7

Sequence similarities: Belongs to the calreticulin family.

Research Articles on CALR3

Similar Products

Product Notes

The CALR3 calr3 (Catalog #AAA648993) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALR3 (Calreticulin 3, Calreticulin-3, Calreticulin-2, Calsperin, CRT2) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CALR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the CALR3 calr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARALVQFWA ICMLRVALAT VYFQEEFLDG EHWRNRWLQS TNDSRFGHFR LSSGKFYGHK EKDKGLQTTQ NGRFYAISAR FKPFSNKGKT LVIQYTVKHE QKMDCGGGYI KVFPADIDQK NLNGKSQYYI MFGPDICGFD IKKVHVILHF KNKYHENKKL IRCKVDGFTH LYTLILRPDL SYDVKIDGQS IESGSIEYDW NLTSLKKETS PAESKDWEQT KDNKAQDWEK HFLDASTSKQ SDWNGDLDGD WPAPMLQKPP YQDGLKPEGI HKDVWLHRKM KNTDYLTQYD LSEFENIGAI GLELWQVRSG TIFDNFLITD DEEYADNFGK ATWGETKGPE REMDAIQAKE EMKKAREEEE EELLSGKINR HEHYFNQFHR RNEL. It is sometimes possible for the material contained within the vial of "CALR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.