Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (66.15kD).)

Mouse anti-Human CALR3 Monoclonal Antibody | anti-CALR3 antibody

CALR3 (Calreticulin 3, Calreticulin-3, Calreticulin-2, Calsperin, CRT2) (HRP)

Gene Names
CALR3; CRT2; CT93; CMH19
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CALR3; Monoclonal Antibody; CALR3 (Calreticulin 3; Calreticulin-3; Calreticulin-2; Calsperin; CRT2) (HRP); anti-CALR3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E3
Specificity
Recognizes human CALR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CALR3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa21-385 from human CALR3 (AAH14595) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (66.15kD).)

Western Blot (WB) (Western Blot detection against Immunogen (66.15kD).)

Western Blot (WB)

(Western Blot analysis of CALR3 expression in transfected 293T cell line by CALR3 monoclonal antibody. Lane 1: CALR3 transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CALR3 expression in transfected 293T cell line by CALR3 monoclonal antibody. Lane 1: CALR3 transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CALR3 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CALR3 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CALR3 over-expressed 293 cell line, cotransfected with CALR3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CALR3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CALR3 over-expressed 293 cell line, cotransfected with CALR3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CALR3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CALR3 antibody
During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (By similarity). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR.
Product Categories/Family for anti-CALR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44,996 Da
NCBI Official Full Name
Homo sapiens calreticulin 3, mRNA
NCBI Official Synonym Full Names
calreticulin 3
NCBI Official Symbol
CALR3
NCBI Official Synonym Symbols
CRT2; CT93; CMH19
NCBI Protein Information
calreticulin-3
UniProt Protein Name
Calreticulin-3
Protein Family
UniProt Gene Name
CALR3
UniProt Synonym Gene Names
CRT2

NCBI Description

The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011]

Uniprot Description

During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR.

Research Articles on CALR3

Similar Products

Product Notes

The CALR3 calr3 (Catalog #AAA6151550) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CALR3 (Calreticulin 3, Calreticulin-3, Calreticulin-2, Calsperin, CRT2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CALR3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CALR3 calr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CALR3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.