Western Blot (WB)
(WB Suggested Anti-THTPA AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Rabbit THTPA Polyclonal Antibody | anti-THTPA antibody
THTPA Antibody - N-terminal region
Gene Names
THTPA; THTP; THTPASE
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THTPA; Polyclonal Antibody; THTPA Antibody - N-terminal region; anti-THTPA antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS
Sequence Length
230
Applicable Applications for anti-THTPA antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 85%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human THTPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-THTPA AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Western Blot (WB)
(WB Suggested Anti-THTPA AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-THTPA antibody
This is a rabbit polyclonal antibody against THTPA. It was validated on Western Blot
Target Description: This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-THTPA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
thiamine-triphosphatase isoform 1
NCBI Official Synonym Full Names
thiamine triphosphatase
NCBI Official Symbol
THTPA
NCBI Official Synonym Symbols
THTP; THTPASE
NCBI Protein Information
thiamine-triphosphatase
UniProt Protein Name
Thiamine-triphosphatase
Protein Family
UniProt Gene Name
THTPA
UniProt Synonym Gene Names
ThTPase
UniProt Entry Name
THTPA_HUMAN
NCBI Description
This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]
Uniprot Description
THTP: Hydrolase highly specific for thiamine triphosphate (ThTP). Belongs to the ThTPase family.
Protein type: Cofactor and Vitamin Metabolism - thiamine; EC 3.6.1.28; Hydrolase
Chromosomal Location of Human Ortholog: 14q11.2
Cellular Component: cytosol
Molecular Function: thiamin-triphosphatase activity; hydrolase activity; magnesium ion binding
Biological Process: thiamin metabolic process; generation of precursor metabolites and energy; vitamin metabolic process; dephosphorylation; thiamin and derivative metabolic process; water-soluble vitamin metabolic process; thiamin diphosphate metabolic process
Research Articles on THTPA
Similar Products
Product Notes
The THTPA thtpa (Catalog #AAA3215803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THTPA Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's THTPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THTPA thtpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KFLPGPGTEE RLQELGGTLE YRVTFRDTYY DTPELSLMQA DHWLRRREDS. It is sometimes possible for the material contained within the vial of "THTPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
